2IGS,2IGS


Conserved Protein Domain Family
DUF3218

?
pfam11508: DUF3218 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF3218)
This family of proteins with unknown function appears to be restricted to Pseudomonas.
Statistics
?
PSSM-Id: 402901
View PSSM: pfam11508
Aligned: 2 rows
Threshold Bit Score: 447.618
Threshold Setting Gi: 118138415
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2IGS_H   5 EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRXV 84  Pseudomonas aeruginosa
2IGS_H   5 EINIYQNPGQSLANIYKGFARQCNPGFVFPEAQTIEAWDIPLRLHPEFIPGGDISKADQQYSTLLAQEIANGVTIGFRXV 84  Pseudomonas aeruginosa
2IGS_H  85 NEKERVCNVEILPLLTSXAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVSYGVNLRTLTPGTW 164 Pseudomonas aeruginosa
2IGS_H  85 NEKERVCNVEILPLLTSXAQNLDRIKARFGSGYLDRFKGSPNVYPTDVGFSTDASGGISQESGLLVSYGVNLRTLTPGTW 164 Pseudomonas aeruginosa
2IGS_H 165 QAXTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVTLLLAYFAAI 217 Pseudomonas aeruginosa
2IGS_H 165 QAXTLPEDIKALVGPGVGLRLDAPNFSDVFNTIKSGLRYTTAVTLLLAYFAAI 217 Pseudomonas aeruginosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap