3SL9


Conserved Protein Domain Family
BCL9

?
pfam11502: BCL9 
Click on image for an interactive view with Cn3D
B-cell lymphoma 9 protein
The Wnt pathway plays a role in embryonic development, stem cell growth and tumorigenesis. BCL9 associates with beta-catenin and Tcf in the nucleus when the Wnt pathway is stimulated leading to the transactivation of Wnt target genes.
Statistics
?
PSSM-Id: 371566
View PSSM: pfam11502
Aligned: 12 rows
Threshold Bit Score: 40.8202
Threshold Setting Gi: 328699244
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3SL9_C                    9 GLSQEQLEHRERSLQTLRDIQRMLFPDeKEFTGAQSGGP 47  
WGS:AAAB:AGAP003918-PA  472 NLTPQQRQHREQQLATLRQMQKMFFPE-QRGMGMDPHGM 509  Anopheles gambiae str. PEST
XP_005159295            373 GLSKEQLEHRERSLQTLRDIERLLLRSgTGVAQEDPRGP 411  zebrafish
XP_023817397            350 GLSKEQLEHRERSLQTLRDIERLFLRSgTAGGPGDAGGP 388  Japanese medaka
XP_009584374            243 GLSKEQLEHRERSLQTLRDIERLLLRSgEAEPFMKSSQn 281  Northern fulmar
XP_017278149            468 GLSQEQLEHRQRSLQTLRDIQRMLFPDdRDAPPPGPPQP 506  mangrove rivulus
XP_005171041            502 GLSQEQLEHRERSLQTLRDIQRMLFPDdKDMAAMGQGNM 540  zebrafish
EFA11241                298 NLTPQQRQHREEQLATIRKMQQMLFPEnQAMDGQPPPgn 336  red flour beetle
XP_003240876            569 NLTPQQRQHREEQQATLRKLQLVLFPEnSNSGGGPSQQq 607  pea aphid
XP_002072634            551 NLTPQQRQHREEQLAKLKKMNQFLFPEhDSGVGGQMIGM 589  Drosophila willistoni
EDX15203                446 NLTPQQRQHREEQLAKIKKMNQFLFPEnENSVGANVSSQ 484  Drosophila simulans
EFN68427                313 NLTPRQRQHREVQLATLRKMQLMLFKDeQSGNALADTTQ 351  Florida carpenter ant
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap