Conserved Protein Domain Family
Cut12

?
pfam11500: Cut12 
Spindle pole body formation-associated protein
This is the central coiled-coil region of cut12 also found in other fungi, barring S. cerevisiae. The full protein has two predicted coiled-coil regions, and one consensus phosphorylation site for p34cdc2 and two for MAP kinase. During fission yeast mitosis, the duplicated spindle pole bodies (SPBs) nucleate microtubule arrays that interdigitate to form the mitotic spindle. Cut12 is localized to the SPB throughout the cell cycle, predominantly around the inner face of the interphase SPB, adjacent to the nucleus. Cut12 associates with Fin1 and is important in this context for the activity of Plo1.
Statistics
?
PSSM-Id: 402896
View PSSM: pfam11500
Aligned: 34 rows
Threshold Bit Score: 100.479
Threshold Setting Gi: 26392360
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EEQ87057          159 SGKKSSKLTKSLIEARSKKsgee--------mkrNENdelfdiMDRKPHS--PAKETSrpkgNQDPpKDRYEDESEDDVT 228  Blastomyc...
XP_007788807      286 gSRRKTTLQQALENSRSSRsk-----------laVQNgeqseePPATLSEnnDGADSEse-wE--------DDVCNHDVT 345  Eutypa la...
XP_003711073      145 TRRPRTSLTEKLEKSRQLQpksqdyefyttkpgnSTKkq-------------qSTEPEdgnwEEVIeDDDDDLDRDRDVT 211  Pyricular...
CAP73690          163 ipKAKTKLQQTLENARRNKae-----------etTTEvrdfasH---------DNEQEga-wEEVD-DDYDESDYEADIT 220  Podospora...
Q2GWD2            125 QPRPKTRLQQAMENSRKANtk-----------dgGTEekdfahA---------AKEPEda-wEEV---EDDESDFDGDVT 180  Chaetomiu...
jgi:MYCTH_2301444 144 QSRPKTKLQQAMEKSRKGSvk-----------qnASDvkdfayP---------SKEPEda-wEEVE--DDDESDIEADVT 200  Thermothe...
EPE02191          135 PKQPRTTLAQALENSRNQYnk-----------aaAEEkqs-----------avGADDDna-wEEVDdNDNDNNGWDPDAT 191  Ophiostom...
CCT67175          110 EPRQRTRLNDALEKASKSVdq-----------knTTQqd--------------qDDSSde-wEEAD----DEDYCTHDIT 159  Fusarium ...
EEU44415          112 ETRHRTRLNEALEKASRSAaq-----------eaATRrn-------------qDDTSDde-wEEAD----DEDCCTHDIT 162  [Nectria]...
XP_013960305      116 avSKRTRLSDVLDKARRKStt-----------nvSKVtep----------riiKDEPEedewEEDE-LDDNGEYYAHDTT 173  Trichoder...
EEQ87057          229 TNLDEPHSQSGIYWKSEFDSYRAKTEREIKKLIQYRSVAKSYAKKKDLEMRRLSEKLKREEAKVSEMELHVSKLAAGMVD 308  Blastomyc...
XP_007788807      346 VDLNEPHSNSGKYWKSEFSRYHDEAQSEMDKLVRYKHMAKSYAKKKDAEAINLTQRLKDEQEKVRKMEQKITEMASQVAD 425  Eutypa la...
XP_003711073      212 VDLNEPHSRSGRYWKTEYQRYHDEARAEMEKLVKYKQLAKAYAKNKDAEAMRLKERLSEEQARVAEMEAKVGELTRQIAI 291  Pyricular...
CAP73690          221 TDLNEPHSRSGQYWKSYFETYHADAKAEMEKLVKYKQLAKSYAKMKDTEADELKQNLREEQEKVQQMEEKLAEMGRQVAA 300  Podospora...
Q2GWD2            181 TDLNEPHSRSGKYWKSYFETYHSDAKMEMEKLVKYKHLAKSYAKMKDTEALELNQKLKEEQGKVKSW--SLCLISRTMLM 258  Chaetomiu...
jgi:MYCTH_2301444 201 TDLNEPHSRSGKYWKSYFETYHSDAKTEMEKLVKYKHLAKSYAKMKDAEALELSRKLKEEQEKVKAMEEKVAEMSRQVAS 280  Thermothe...
EPE02191          192 VDLNEPHSQSGRYWKSQFQRYQEDAKVEMSKLLKYKQLAKSYAKMKDSEAGDMHAKLREEKDKVTQMEARITQLANQIAR 271  Ophiostom...
CCT67175          160 VDLNEPHSQSGRYWKEEFEKYHEDAKTEMEKLLKYKQLAKSYAKQKDAEAIELAVKLKEEQQKVIEMERQIAEGASKITS 239  Fusarium ...
EEU44415          163 VDLNEPHSQSGKYWKEEFEKYHDEAKVEMEKLLKYKQLAKSYAKQKDAEASDLAVKLKEEQQKVIEMEKQIAEGASRIAS 242  [Nectria]...
XP_013960305      174 VDLNEPHSQSGKYWKEEFEKYHREARAEMEKLLKYKKHLKSYAEEKDLEAIHLAQRLKEEQEKVIAMEKRIAENANQMAS 253  Trichoder...
EEQ87057          309 GTNKTGsNE 317  Blastomyces dermatitidis ER-3
XP_007788807      426 KRKQGAnKd 434  Eutypa lata UCREL1
XP_003711073      292 RVSNSggsm 300  Pyricularia oryzae 70-15
CAP73690          301 KTQRNGgqa 309  Podospora anserina S mat+
Q2GWD2            259 DANDNNeQH 267  Chaetomium globosum CBS 148.51
jgi:MYCTH_2301444 281 ASTRKgges 289  Thermothelomyces thermophilus ATCC 42464
EPE02191          272 KRTKGSdhd 280  Ophiostoma piceae UAMH 11346
CCT67175          240 KRVDRSdev 248  Fusarium fujikuroi IMI 58289
EEU44415          243 KRDDRSddv 251  [Nectria] haematococca mpVI 77-13-4
XP_013960305      254 KQNSASsSE 262  Trichoderma virens Gv29-8
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap