Conserved Protein Domain Family
Activator_LAG-3

?
pfam11498: Activator_LAG-3 
Transcriptional activator LAG-3
The C.elegans Notch pathway, involved in the control of growth, differentiation and patterning in animal development, relies on either of the receptors GLP-1 or LIN-12. Both these receptors promote signalling by the recruitment of LAG-3 to target promoters, where it then acts as a transcriptional activator. LAG-3 works as a ternary complex together with the DNA binding protein, LAG-1.
Statistics
?
PSSM-Id: 151935
View PSSM: pfam11498
Aligned: 2 rows
Threshold Bit Score: 423.99
Threshold Setting Gi: 187031262
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q09260    23 MKPSTSK---TTHSPPPEEPTAPFVNDNLPNPEDEPTIGDLNAFHSGEELHRQRSELARANYEKARPEMIANQRAVTAHL 99  Caenorhabditis elegans
CAP29323   1 MKPSTSKagsSAQSPPPEEPNSAYVNNELPDPDDEPLVSEMTVYNKGQEEARLRSQEAYEKFQKTRQESISSQRAVTAQL 80  Caenorhabditis brig...
Q09260   100 FNRYTEDEERKRVEQQKNKEAMNASTSapTSSRNGgqSVENRKRRNDvvVAPPTSEEEWKRA-QQQHWMGQQQPQM-QFQ 177 Caenorhabditis elegans
CAP29323  81 YHRFTEDEERKRMEHQKNKEAMNASVA--SASRNG--HIDNRKRRND--VGSLSAEEEWRRAqQQQHWMGQAAPMHpSYQ 154 Caenorhabditis brig...
Q09260   178 MQQQYHsQQQqyimMQQQHHHMTgmqqihhqmpstssadSIRSVPTPaSSMHQPSPAEMRNGCgmsrnatmdmtcspmsg 257 Caenorhabditis elegans
CAP29323 155 MQQQYH-QQQ----VAAQHHQFM----------------APHSVPTP-GSIHRPSPSGMQSVC----------------- 195 Caenorhabditis brig...
Q09260   258 gQPIVDENNLAVPEGEWFDKLALAVAEQYNVDTILGPDTYDTFLAELDFSSSESPTKQSPMEMNgdrmpSTAPPPaQNPQ 337 Caenorhabditis elegans
CAP29323 196 -LPTSDENSLDVPNGEWFDKLAVMVAEKYDATTILGPDTYDVYLNELDAMEPVGETVKTPSEAG-----QSASQP-MNPQ 268 Caenorhabditis brig...
Q09260   338 HiAQLQQQQNKMRLMQQQQQemqrIEQQRRQQIMQQQQQQqqqeHQRQQMLLqQQQQQQQMQQHHQMNgGGQFaTQAHQQ 417 Caenorhabditis elegans
CAP29323 269 Q-QQMAQQQNKMRMLQQQEM----MEQQRQQQMMHQHQQQ----HRQQQMLL-QQQQMHQLQQQNQMN-GGQF-TQAQQH 336 Caenorhabditis brig...
Q09260   418 AAYMQQMQRM---EQIRHQQQQAQQHQQAqQQHQQQAQHHQMGYGIPNGYpQQMHMHPPaYGaHHMPQPTAFANIN 490 Caenorhabditis elegans
CAP29323 337 AVYLQRMQHMrlqQQQQQQQQQAQHHQQA-QQHQQPHQNGVMGYSVPNGY-AHPNGYAP-YG-HHMPHHTPFANIN 408 Caenorhabditis briggsae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap