3QPH


Conserved Protein Domain Family
Regulator_TrmB

?
pfam11495: Regulator_TrmB 
Click on image for an interactive view with Cn3D
Archaeal transcriptional regulator TrmB
TrmB is an alpha-glucoside sensing transcriptional regulator. The protein is the transcriptional repressor for gene cluster encoding trehalose/maltose ABC transporter in T.litoralis and P.furiosus. TrmB has lost its DNA binding domain but retained its sugar recognition site. A nonreducing glucosyl residue is shared by all substrates bound to TrmB which suggests that its a common recognition motif.
Statistics
?
PSSM-Id: 402893
View PSSM: pfam11495
Aligned: 22 rows
Threshold Bit Score: 197.122
Threshold Setting Gi: 500077238
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3QPH_A        110 AIWRSRSFDEAIEMFRESLYSAKNEVIVVTPSEFFETIREDLIKTLERGVTVSLYIDK---IPDLSEFKGKGNFFVRQFY 186 Pyrococcus fur...
Q9HKB6        119 ALINAKNIRSVINNSIDLINETEKTLEIETTQELFAYIREPILRKIREGCRVEILFFGtdvDLEKVQNQFTDLDVDVRYV 198 Thermoplasma a...
jgi:Cmaq_0601  95 QIYVSYGIDGLNNGLVEVISNAQVELYGEIPSWILRKNLRLFMDALGRGVRLYLLVYPsisEEDLHPLREYEDAAWIKVN 174 Caldivirga maq...
jgi:Cmaq_1188 115 LLWVTRGIDNVIYNSASLIQEANSELYVSAPPVLLSRLLKYM-SSIDPKVKAYILVYPslnDELLNELKGIKSVVEVKVN 193 Caldivirga maq...
Q5JJ60        112 EIWTIQGFDNTLERAEHVIRTAKHEVLINTPFEFLKLLQGEIKNRKD----VIFVIIS---NFGDEIPNWLKG-DNIILA 183 Thermococcus k...
WP_011753251  118 RVRVIKNKSEAILRARKMLENASYDALVAGPPRLVGEILPHSVGGGAARRLVAVVYYE-----GVEEPLPAEPWLGLRLR 192 Thermofilum pe...
jgi:Tpen_1154 118 GVWTAVGQNAGESLFLSALESARHELLVAGYSKFLRGFLDRLART---DLATCLVLYD-----GEDIGSFVNVFDEVRLR 189 Thermofilum pe...
Q9HIL5         80 FLSLVEGYDNIIQKMQTMINEAQNEIIISLSQEKFNDLREDLQRASSRKVTVVLLVFT---DGDVAF----DGRALIRKI 152 Thermoplasma a...
Q6KZ13        114 SLWLIKSKTKLKTTILDSIKNAETEIIISASYENLKSLSSYIREAAKNGVTVSIVIFN---DSPSAFIDMLSKYSVIRVR 190 Picrophilus to...
Q6KYU4        110 YLWYMDNEALIKEQIKELIINAKSEIICSLKLPMLRYLDRYLINAANRGVSVIIVIFP---DSDRYDITDLLNTTVLKRR 186 Picrophilus to...
3QPH_A        187 KLNH--LI----GMTDGKEVVTIQNAtfdsigppSFKSTYPEIIFSQYSLIIEI--------FKESTLEKe--IIGNPKD 250 Pyrococcus fur...
Q9HKB6        199 SPGQf-FT----VISDEKNSVFMPRSva-----mNTDIERYGYVIRDKDMSWFIthnf-fvgWYRGNRIK---DHSVVAP 264 Thermoplasma a...
jgi:Cmaq_0601 175 KLGDf-LL----LAADLSKGVYASRRs------lTVNEGSHCYIIQDKDIITRFltif-nstWKESEDALyvdPSRGKYP 242 Caldivirga maq...
jgi:Cmaq_1188 194 RLGPf-YF----ISPNAESCVFASSRvs-----lLREPETYGYVFRDRTMTLQFihgf-fdtWRRAQTVYrrgFKPSDYP 262 Caldivirga maq...
Q5JJ60        184 RSGGapWLmaswIIGDIDYALFFGALpk-----dRRREKFYSFWAKSPRIIQNYmhwfytiyFDNSEVIKplaYERLQKP 258 Thermococcus k...
WP_011753251  193 SVGVipL-----VIADSARAVIL--------------RESYALEIAEEDLIRTFldfyyhalWRVSSVVKp-fEPVEGFE 252 Thermofilum pe...
jgi:Tpen_1154 190 PTRAp-QM----AIPDFSQVVIVSG---------WESGQVTAYKVTDDNLMRIFavyyldylRGSGKVVAa--KFGQLER 253 Thermofilum pe...
Q9HIL5        153 NGKPt-EM----AISDRKSCVVSVEG--------ERENKEYALYFEEDNFIHVMsyyfnqslWSQAVIIR---DFFIAES 216 Thermoplasma a...
Q6KZ13        191 DAPPa-EM----MLVDRSRAIVDVGS--------MLQNADYSIMLDEDELIHMLtyyffytiWSPSRYIY---DFTRMTS 254 Picrophilus to...
Q6KYU4        187 PGISp-EI----FIVDREESIVKVDD--------ISKKLVYAIDFQEAEMIHILnyyyynivWKPSMYIS---KFMIKNE 250 Picrophilus to...
3QPH_A        251 IRFFAMFHAVDFVKNHL-KNRNIYAEITGKNLESGRLETLTGRVVGYTLSLREA-VNNIHLETENG-VVKVGGMFAVIED 327 Pyrococcus fur...
Q9HKB6        265 YTYHSQRILISDLKRIFdQKGRVHGVLEGIVRSTGDRFTSEGEISE--INSDTE-IINFVFKTDRG-EYTVGGYDSQIED 340 Thermoplasma a...
jgi:Cmaq_0601 243 RKFLNIHFALLTLEALLtHGYNPVVSVKGILLKNNEPIEVRGVVSS--VNMLNR-VSNIVVRSNGN-QYTIGGYDAELED 318 Caldivirga maq...
jgi:Cmaq_1188 263 LVFNSHRFATWEILKAKeSKLSIEVRVKGYLTSSNEEVDVTGIPLN--VTIDSDiVNFELLPSNGNkALLIGGTNALIED 340 Caldivirga maq...
Q5JJ60        259 VSLVNIRTLITVLKF---AGLPRKAEIVGKLIDTKEPVTLDGEIVD--YEYTPL-TANVTFKYNGK-QLKVGGIGSYFED 331 Thermococcus k...
WP_011753251  253 YTATSIWLLNEVLKECLgRGLGAEVTVAGVERRTGRSVTLTGRPAEISENGQGV-RVSLVLEVGQR-KITVGGLGARLED 330 Thermofilum pe...
jgi:Tpen_1154 254 RTYHHMTRALEHINALLgAGRKPVLTVRGRWVATGEEATVRGVPVRLFENSFRS-VGTILLKLEDGrEVSVGGVGAYLED 332 Thermofilum pe...
Q9HIL5        217 IKFCNIWITCDAIDFLLsRNMRVFAEVEGFY--HDDRRTWKGEILK--TEKIPFvRNTFYINVGDR-TYSVGGKTATLED 291 Thermoplasma a...
Q6KZ13        255 IKLTTSWLACEAIENLKeSGFKIMADLKGIL--ENRPVELKGEIIG--TKRVMGvRQSFIIKVNDE-EFSVGGKNAKLED 329 Picrophilus to...
Q6KYU4        251 WRFNTSWISCEAINTFInNGYKLTGRVIGNT--QNGQIDITGTIKG--TDIIPGyKNSFLIQSEDQ-VFTVGGRLTRIED 325 Picrophilus to...
3QPH_A        328 YESTEIKFIMG 338 Pyrococcus furiosus
Q9HKB6        341 IVMKSFTVASF 351 Thermoplasma acidophilum
jgi:Cmaq_0601 319 IEAQEVVIESI 329 Caldivirga maquilingensis IC-167
jgi:Cmaq_1188 341 IESEYIEIRLM 351 Caldivirga maquilingensis IC-167
Q5JJ60        332 VEGEKFIL-LE 341 Thermococcus kodakarensis KOD1
WP_011753251  331 VEGRVFRLKVL 341 Thermofilum pendens
jgi:Tpen_1154 333 VEAYEITVEAR 343 Thermofilum pendens Hrk 5
Q9HIL5        292 IKMISVLLHPS 302 Thermoplasma acidophilum
Q6KZ13        330 IKMQSVVIYPK 340 Picrophilus torridus
Q6KYU4        326 IRMEELYLKAE 336 Picrophilus torridus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap