2EHW


Conserved Protein Domain Family
DUF3209

?
pfam11483: DUF3209 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF3209)
This family of proteins has no known function.
Statistics
?
PSSM-Id: 402885
View PSSM: pfam11483
Aligned: 11 rows
Threshold Bit Score: 143.665
Threshold Setting Gi: 490140752
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2EHW_D           2 ACHELSALRIAIGELLE-KEAHDLLHEREELAPVLGq--rPELKRLAEAKTLPALEEALREALLHLEERAAQ----EPEE 74  Thermus therm...
Q9HPM5           2 TCHELEALRLGLMNVLGtSDRSAREHAEKELEGELH----GPIEGLAEADSLAELQRHLDAALVDLEGEVAAtdesNAEY 77  Halobacterium...
jgi:Natgr_0112   2 ACAELEALRLALMTLNGtVDESVKRHAEAEIGDELEn--nGPIAALASAETLEEIQRHLDAALVDLEEEAADadstDPYG 79  Natronobacter...
CCQ37891         2 TCHEIEALRLGLMNSLGvADDAVEKHARDELGADPD----PHIEALAEAESLAACKRHLDTALVELEGEVASadadDPGY 77  Natronomonas ...
WP_011322280     2 SCHEIEALRLGLMNSLGiGDDATRRHARDELGDDPE----PHIAALADAESLAACRRHLDTALVELEAEIAEadpeAPDY 77  Natronomonas ...
WP_004041101     2 ACAELEALRLALLNITGtTDEHAKRHAEAELEDYLGdadpGPIQALANATTLDEAQRHLDAALVDLESEATRidddDPQA 81  Haloferax
Q8EXP4           2 acheiaalRLGMMNLIGiKDETTIRHEQSEIGTVLEs--pGPIRSLAEAKDFESLIKFYEISLTDLEEKISKmkkdDPKM 79  Leptospira in...
CAN90400         2 ACHEIAALRLGLMNILGiDDPAERTHELAELGAAAAe--pGPVSAMLRAGDLKNLSRLFEGSLVELQEKVAKtpagDPKL 79  Sorangium cel...
CBK41812         2 ACHEIAALRLGLMEILGvKDEAERQHELAELGAGADq--pGPIRSMCGAKDLARLKQCYEGAVAGLEARVSAtradDPKL 79  Nitrospira de...
Q18FX1           2 TCHEIEALKLGLMNVLGtTDESARQHAYAELEGALE----GPIEALAEAEDLSAVQRHLDAALVDLEETVATteksDPEY 77  Haloquadratum...
Q5UYB5           2 SCYEIEALRLGLMNVLGtEDDHARQHAEQELEGHMT----GPIEALAGAKTLAAIERHLDAALVDLEEEIAAtpedDPEY 77  Haloarcula ma...
2EHW_D          75 PYWRGLLLAVEAXEGRLKALRAEAEALYQDLDALHGRLHRLFPRR 119 Thermus thermophilus HB8
Q9HPM5          78 DYLRGRLVAVRDAERALARLADHGDAYLDDLGATHHALHDVFPAD 122 Halobacterium salinarum
jgi:Natgr_0112  80 AYLRGRIVAVRDAEQRIRRLRERTDGLLEDFGETHHTLHETFPIE 124 Natronobacterium gregoryi SP2
CCQ37891        78 DYLRGRLVAVRDAEAALDRLLTQGEGFLDDLGDIHHALHETFPTD 122 Natronomonas moolapensis 8.8.11
WP_011322280    78 DYLRGRLVAVRDAENALERLLSHGDAFLDDLGESHHTLHEAFPVD 122 Natronomonas pharaonis
WP_004041101    82 GYLRGRLVAVRDAERSLRRLREGTDALLDDLGEAHHTLHDAFPVE 126 Haloferax
Q8EXP4          80 AYYRSLLILTKKIEFELKNSVFIFQNFFRDLEEIHDFVHEIFPA- 123 Leptospira interrogans
CAN90400        80 PYLRSLLILTKQVELDLRAQVDGLGRLYRELEEMHDFVHEIYPAe 124 Sorangium cellulosum So ce56
CBK41812        80 PYLRTLIVLTKKVDLDLAHQIEGLRHLYRDLDEMHDFVHEMYPAe 124 Nitrospira defluvii
Q18FX1          78 DYLRGRLIAVRDAEQSIQRLSMQGESVLNGFAETHDLLHETFPVD 122 Haloquadratum walsbyi DSM 16790
Q5UYB5          78 DYLRGRLVAVRDAERAVSRITMQGEDVLAGLGEAHDVLHEAFPVD 122 Haloarcula marismortui
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap