2EBG


Conserved Protein Domain Family
DUF3208

?
pfam11482: DUF3208 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF3208)
This bacterial family of proteins has no known function.
Statistics
?
PSSM-Id: 402884
View PSSM: pfam11482
Aligned: 13 rows
Threshold Bit Score: 129.841
Threshold Setting Gi: 157834886
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2EBG_A                1 MQAVRLFQGYLWHPRALALDLKALLPGEV-----------AGAR--LLWDEVPPPTPFFEDGTPTHTQRFYQLTLLVLTE 67  Thermus ...
zhongguo:DGo_CA1654  14 RSAIRLLQGYVWHPAGADVDLEHYLPRDLdlapvpgisetEEAH--VLWDQVTPPFAFFENGEPTAGQTFYQFTVLRVYD 91  Deinococ...
Q9RSG8               11 RAAVRLLQGYLWYPEGADVDLESFLPRELdlsqa-pslseEDAH--VLWDQVQPPFAFFENGEPTASQTFYQFTVLRVYD 87  Deinococ...
WP_013556444         21 RAAVRLLQGYVWHPRDLDMDLESYLPHEL-----------DDAY--VLWDPVNPPFAFFENGEPTASQVFYQFTTLQMYD 87  Deinococ...
jgi:Deipe_3474        7 lQPIRLLQGYLWHPRDAGIELSGYLPQEL-----------SGAR--LVWDEVTPPFAFFENGELTSSQVFYQFTTFRVYE 73  Deinococ...
jgi:Trad_2809         7 krTFKLLQGYIWFPRDAQVELGDFLPERL------------EPDiyLLWDEVPPPFAFFDDGTLAATQRVFQFTALAKGR 74  Truepera...
WP_013456921          3 eRAVRLLQGYLWVPQERAWDPQLELPATLd---------lGEADavLLVDPIRPPFAFFDDGTPTASQRFYQLTALVLTD 73  Oceanith...
ACO46091             11 RAAVRLLQGYMWHPQDADVDLDHYLPRELelpdppgmsgtEDAH--VLWDSVQAPFAFFENGEPTASQVFYQFTVLRVYD 88  Deinococ...
AEB10957              1 MRAVKLFQGYLWHPKDRGLEGRALLPECLevp-----fagGAARvwVLVDAVPPPFAFFEDGTPTATQAFYQVTLLTKTE 75  Marinith...
jgi:Mesil_0326        1 MKAVKLFQGYLWFPRELEFEPKEALPAEVaqg-----ladGPAH--LLLDEIRPPFAFFEDGTPTEGQRFFQVTVLVRTE 73  Meiother...
jgi:Mrub_0204         1 MKAIKLFQGYLWHPKELSFDPREAIPRQL-----------GEVH--VLIDKVRAPMTFFEDGTPTETQQFYQVTLLVRTE 67  Meiother...
WP_013614753         15 RAAIRLLQGYLWHPRELSMDLDAYLPREL-----------DEAN--VLWDEIDPPFAFFDNGEPSSGQVFYQFTVLRVYE 81  Deinococ...
WP_011530019         13 RAAVRLLQGYLWHPKDADVDLENYLPHEL-----------DEAH--VLWDVVNAPFAFFENGEPTAGQLFYQFTVLRVYD 79  Deinococ...
2EBG_A               68 EPP--EALKPLAEEAAEALGEVLEGLPPEVGWLLLEDLRPL 106 Thermus thermophilus
zhongguo:DGo_CA1654  92 ERPgnDALHGDAESASQSLGPLLESTPEGVGWQLWEDLRDL 132 Deinococcus gobiensis I-0
Q9RSG8               88 ERPsnEELHDDATIASQALNPLLEGTPQGVGWQIWEDLRDL 128 Deinococcus radiodurans
WP_013556444         88 EKPdaDTMHAHAQAVSEALNPLLEGTPPGVGWQLWEDLRDL 128 Deinococcus maricopensis
jgi:Deipe_3474       74 RRPdnDTLHAHAQGLSEALGPLLERTPPGVGWQLWEDLREL 114 Deinococcus peraridilitoris DSM 19664
jgi:Trad_2809        75 TEReaQGLVPW---LAETLQRRLEATPPGVGWQVMEDLRSL 112 Truepera radiovictrix DSM 17093
WP_013456921         74 RDP--NALHPWVAALQERLAPVLEATPAGVGWLLFEDLRAL 112 Oceanithermus profundus
ACO46091             89 ERPgnDALHADASAASQTLNPLLESTPAGVGWQLWEDLRDL 129 Deinococcus deserti VCD115
AEB10957             76 RAP--AELKPLSEAVAARLEPLLNALPEGVGWLLLEDLREv 114 Marinithermus hydrothermalis DSM 14884
jgi:Mesil_0326       74 KEP--LELKPLTASVSEELDPYLQATPEGVGWLLLEDLRQv 112 Meiothermus silvanus DSM 9946
jgi:Mrub_0204        68 QEP--QDLKPLALWVSQALKPYLEATPKEVGWQLLEDLRQv 106 Meiothermus ruber DSM 1279
WP_013614753         82 ERPgaEQLHADAQEASQALEPLLQATPAGLGWQLMEDLREL 122 Deinococcus proteolyticus
WP_011530019         80 DKPggESLHADAEAASQALGPLLEATPPGVGWQLWEDLREL 120 Deinococcus geothermalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap