2B2A,2B2A


Conserved Protein Domain Family
N-Term_TEN

?
pfam11474: N-Term_TEN 
Click on image for an interactive view with Cn3D
Telomerase reverse transcriptase TEN domain
This is the N terminal domain of the protein telomerase reverse transcriptase called TEN. The TEN domain is able to bind both RNA and telomeric DNA and contributes towards telomerase catalysis. The TEN domain has a structure that consists of a core beta sheet surrounded by seven alpha helices and a short beta hairpin.
Statistics
?
PSSM-Id: 431903
Aligned: 2 rows
Threshold Bit Score: 323.603
Threshold Setting Gi: 90108789
Created: 21-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2B2A_C  12 INNINNNKQMLTRKEDLLTVLKQISALKYVSNLYEFLLATEKIVQTSELDTQFQEFLTTTIIASEQNLVENYKQKYNQPN 91  Tetrahymena thermophila
2B2A_C  12 INNINNNKQMLTRKEDLLTVLKQISALKYVSNLYEFLLATEKIVQTSELDTQFQEFLTTTIIASEQNLVENYKQKYNQPN 91  Tetrahymena thermophila
2B2A_C  92 FSQMTIKQVIDDSIILLGNKQNYVQQIGTTTIGFYVEYENINLSRQTLYSSNFRNLLNIFGEEDFKYFLIDFLVFTKVEQ 171 Tetrahymena thermophila
2B2A_C  92 FSQMTIKQVIDDSIILLGNKQNYVQQIGTTTIGFYVEYENINLSRQTLYSSNFRNLLNIFGEEDFKYFLIDFLVFTKVEQ 171 Tetrahymena thermophila
2B2A_C 172 NGYLQVAGVCLNQYFSVQVKQKKWYKNN 199 Tetrahymena thermophila
2B2A_C 172 NGYLQVAGVCLNQYFSVQVKQKKWYKNN 199 Tetrahymena thermophila
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap