1ZTD


Conserved Protein Domain Family
Ribonucleas_3_2

?
pfam11469: Ribonucleas_3_2 
Click on image for an interactive view with Cn3D
Ribonuclease III
This is a family of archaeal ribonuclease_III proteins.
Statistics
?
PSSM-Id: 402878
View PSSM: pfam11469
Aligned: 3 rows
Threshold Bit Score: 154.36
Threshold Setting Gi: 119524400
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1ZTD_A         13 KGLAKFGDSLINFLYSLALTEFLGKPTGDRVPNASLAIALELTGLSKNLR-RVDKHAKGDYAEALIAKAWLMGLISEREA 91  Pyrococcus fur...
Q5JE89         13 KGLAKLGDSLINLVFSLALSEYLGKPTGERVPNASLAIALEMAGLRHIIPpRTDKHGKGDIAEALFAYAWLEKKITIEEA 92  Thermococcus k...
jgi:Tpen_0363  16 KELARLGDSLVNFLVSAALT-LIGRPTGVKVPGETLARAFLSSRLSKLGKpR--GIAPGEAMEAFLAYAWLKGSLSCEES 92  Thermofilum pe...
1ZTD_A         92 VEIIKKNLYPEVLDFSKKKEAIGRALAPLLVIISERLYS 130 Pyrococcus furiosus
Q5JE89         93 VEILSQNLDDDVTHFTRKKETIGKAFAVLYEEIGKRLGL 131 Thermococcus kodakarensis KOD1
jgi:Tpen_0363  93 VEMLYTGL--------REGYDVAQALAKLADYLLEKIEA 123 Thermofilum pendens Hrk 5
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap