1YB3


Conserved Protein Domain Family
DUF3201

?
pfam11447: DUF3201 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF3201)
This archaeal family of proteins has no known function.
Statistics
?
PSSM-Id: 402862
View PSSM: pfam11447
Aligned: 2 rows
Threshold Bit Score: 221.779
Threshold Setting Gi: 60594196
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1YB3_A  16 ELLNRIWGDIFELREELKEELK--GFTVEEVSEVFNAYLYIDGKWEEXKYPHPAFAVKPGGEVGATPQGFYFVFAFPKEE 93  Pyrococcus furiosus
Q5JEW8  12 EFLNKLWEDVFTLNEELKEELPrfGFKVEDVEEVFGAYLFLDGEWRQMLYPHPAFEVKPQIEVGATPESYYFVVAVPKEK 91  Thermococcus kodakare...
1YB3_A  94 LSKEFIEDVIRAFEKLFIYGAENFLEDFYN--FEHPISgDEVWDRIVNSDEEXINFEVDLGfDKEEVKREIKR 164 Pyrococcus furiosus
Q5JEW8  92 ISEDFLEAFLEAFPKSFIYGSEDFLNDVYNcmRDSPLS-EEIIKRIHESSEKVFQFEANFD-DVEKLKEGLFK 162 Thermococcus kodakarensis KOD1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap