2LHK


Conserved Protein Domain Family
T3SchapCesA

?
pfam11439: T3SchapCesA 
Click on image for an interactive view with Cn3D
Type III secretion system filament chaperone CesA
This family represents a chaperone protein for the type III secretion system - TTSS - translocon protein EspA, to prevent the latter's self-polymerization. The TTSS is a highly specialized bacterial protein secretory pathway, similar in many ways to the flagellar system, that is essential for the pathogenesis of many Gram-negative bacteria. The twenty or so proteins making up the TTSS apparatus, referred to as the needle complex, allow the injection of virulence proteins (known as effectors) directly into the cytoplasm of the eukaryotic host cells they infect; however, the injection process itself is mediated by a subset of extracellular proteins that are secreted by the needle complex to the bacterial surface and assembled into the type III translocon - EspA. EspB and EspD. EspA polymerizes into an extracellular filament, and, as with other fibrous proteins, is apt to undergo massive polymerization when overexpressed. CesA is the secretion chaperone protein that binds to EspA. CesA is dimeric and helical, and it traps EspA in a monomeric state and inhibits its polymerization.
Statistics
?
PSSM-Id: 371535
View PSSM: pfam11439
Aligned: 3 rows
Threshold Bit Score: 118.374
Threshold Setting Gi: 365812816
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2LHK_A                        1 MSIVSQTRNKELLDKKIRSEIEAIKKIIAEFDVVKESVNELSEKAKTDPQAAEKLNKLIEGYTYGEERKLYDSALSKIEK 80 
CBG89744                      1 MNIVKQTKNKELLDKKIRSEIETIKKIIAEFDVIKENVNILSEKAKTSPQAAETLNKLIEGYTYGEERRLYDSALSKIEK 80  ...
PRJNA178647:ECRM12581_23300   1 MSIVSQTRNKELLDKKIRSEIEAIKKIIAEFDVVKESVNELSEKAKTDPQAAEKLNKLIEGYTYGEERKLYDSALSKIEK 80  ...
2LHK_A                       81 LIETLSPARSKSQST 95 
CBG89744                     81 LIETMKPTRSGSQLT 95  Citrobacter rodentium ICC168
PRJNA178647:ECRM12581_23300  81 LIETLSPARSKSQST 95  Escherichia coli O145:H28 str. RM12581
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap