1XEE


Conserved Protein Domain Family
CHIPS

?
pfam11434: CHIPS 
Click on image for an interactive view with Cn3D
Chemotaxis-inhibiting protein CHIPS
The chemotaxis inhibitory protein, CHIPS, is an excreted virulence factor which acts by binding to C5a and formylated peptide receptor (FPR), blocking phagocyte responses. A fragment of CHIPS, which contains residues 31-121 comprises of an alpha helix packed onto a four stranded anti-parallel beta-sheet. Most of the conserved residues of CHIPS are present in the alpha-helix.
Statistics
?
PSSM-Id: 371531
View PSSM: pfam11434
Aligned: 3 rows
Threshold Bit Score: 168.37
Threshold Setting Gi: 1390365060
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1XEE_A   1 NSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVI 80 
Q2FWV5  59 NSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVI 138 Staphylococcus aureus...
Q2FWV5  59 NSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVI 138 Staphylococcus aureus...
1XEE_A  81 NGPGKTNEYAY 91 
Q2FWV5 139 NGPGKTNEYAY 149 Staphylococcus aureus subsp. aureus NCTC 8325
Q2FWV5 139 NGPGKTNEYAY 149 Staphylococcus aureus subsp. aureus NCTC 8325
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap