1X9B


Conserved Protein Domain Family
DUF3198

?
pfam11433: DUF3198 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF3198)
Some members in this family of proteins are annotated as membrane proteins however this cannot be confirmed. Currently, this archaeal family has no known function.
Statistics
?
PSSM-Id: 371530
View PSSM: pfam11433
Aligned: 7 rows
Threshold Bit Score: 65.9203
Threshold Setting Gi: 159163603
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1X9B_A     4 SDRAKFESMINSPSKSVFVRNLNELEALAVRLGKSYRIQLDQAKEKWKV 52  Thermoplasma acidophilum
Q6L1F3    73 KDTIDFNRYIGSESKKMFMEHLTELERISKRFDGSYEERLEEAKKKWKL 121 Picrophilus torridus
EDY35587  79 RKRLKFEEYINSESKREFVNNLRELEEISYKLGEKYQNRLEEKKREWRV 127 Aciduliprofundum boonei T469
EQB66874  75 KEDRKFISMTSSESKQTFMKNLKSLEKIARKHGSRFQSMLNEAKEKWKV 123 Thermoplasmatales archaeon E-plasma
EQB67994  75 dDDRFFMKNINSDSKSHFMKNMKKLEKIAREHGSLYQQMLQNKKSFWKI 123 Thermoplasmatales archaeon Gpl
EQB70952  75 tqTKRFEDLISSDSKYTFVKNIKELQKLARDLGPRYGQQLNQAMEKWKI 123 Thermoplasmatales archaeon A-plasma
EQB65290  76 SQRRKFEELILTDSKATFVKNERDLDIISRKLGPSFRKRYEEKKDQLRV 124 Thermoplasmatales archaeon I-plasma
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap