1RKI


Conserved Protein Domain Family
DUF3195

?
pfam11424: DUF3195 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF3195)
This archaeal family of proteins has no known function.
Statistics
?
PSSM-Id: 402851
View PSSM: pfam11424
Aligned: 2 rows
Threshold Bit Score: 128.936
Threshold Setting Gi: 60593445
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1RKI_B         4 HIIIKTIPKKEEIISRDLCDCIYYY-DNSVICKPIGPSKVYVSTS-LENLEKCLQLHYFKKLVKNIEIFDEV--HNSKPN 79  Pyrobaculum aer...
WP_014127716   2 IALLTTLGGKERSVAQDLCDCLYGNgDTQVRCEPIYPGVLFVEFQrRETLELCLSMKYFRVLVRRIEIYEKVvrSTETPP 81  Thermoproteus t...
1RKI_B        80 CDKCL 84  Pyrobaculum aerophilum
WP_014127716  82 GAKKV 86  Thermoproteus tenax
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap