1MM0


Conserved Protein Domain Family
Toxin_37

?
pfam11415: Toxin_37 
Click on image for an interactive view with Cn3D
Antifungal peptide termicin
Termicin is a cysteine-rich antifungal peptide which exhibits antibacterial activity. A cysteine stabilized alpha beta motif is formed due to an alpha-helical segment and a two-stranded antiparallel beta-sheet.
Statistics
?
PSSM-Id: 151854
View PSSM: pfam11415
Aligned: 8 rows
Threshold Bit Score: 45.1283
Threshold Setting Gi: 159162700
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1MM0_A  2 CNFQSCWATCQAQHSIYFRRAFCDRSQCKCVFVRG 36  Pseudacanthotermes spiniger
Q5SDI6 27 CDFQSCWVSCQRQYNIYFRKAYCEKSKCMCVYNYG 61  Nasutitermes pluvialis
Q5SDH7 27 CNTKACWALCQREHGIYFRRAVCEGSRCKCILVNG 61  Drepanotermes rubriceps
Q5SDH6 27 CNRNACWASCQRQHGIYFRRAFCEGSRCRCVRVNG 61  Drepanotermes rubriceps
Q5SDI7 27 CDFQSCWVTCQRQHSIYFIRAFCDGSRCMCVYNNG 61  Nasutitermes magnus
Q5SDJ4 27 CDFNSCWATCKAQNGIYFRRAFCDGPTCLCVFLNA 61  Nasutitermes comatus
Q5SDI5 27 CDFHSCWATCQAQHGICFRRAYCDGPSCQCVFLNQ 61  Nasutitermes pluvialis
Q5SDJ1 27 CNFQSCWAICKAHYGIYFRRAYCDGPNCQCVHLIQ 61  Nasutitermes exitiosus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap