5MR2


Conserved Protein Domain Family
VERL

?
pfam11386: VERL 
Click on image for an interactive view with Cn3D
Vitelline envelope receptor for lysin
VERL, the egg vitelline envelope (VE) receptor for lysin, is a giant unbranched glycoprotein comprising 30% of the vitelline envelope. Lysin binds to VERL and creates a hole as VERL molecules lose cohesion and splay apart. These proteins are important in the mediation of fertilisation
Statistics
?
PSSM-Id: 371502
View PSSM: pfam11386
Aligned: 6 rows
Threshold Bit Score: 126.975
Threshold Setting Gi: 74817854
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5MR2_A  44 VPITHEHGFNMMLIQYTRNKLLDSPGMCVFWGPYSVPKNDTVVLYTVTARLKWSEGPPTDLSIQCYMPKSPD--APKPEA 121
Q8MZV0 245 VPITREHGFNMMPIHYNRNKLPDSPGMCVFWGPYSVPKNDTVVLYTVTARLKWSEDPPTILSIDCYMPKSPV--APKPES 322 pink abalone
Q9BKI3  32 VPITHEFGINMMLIQYTRNELLDSPGMCVFWGPYSVPKNDTVVLYTVTARLKWSEGPPTNLSIECYMPKSPV--APKPEA 109 red abalone
O76320   1 VPITQESGINMMLIQYSLNDSLDSPGMCVFGGPYSVPKNDTVVLYTVTARLKWSEGPPTNLPIECYMPKSPV--SPEPEA 78  pink abalone
Q8MZU8  35 MQMPRGSAFN-ISIHYPQPYTSVIPGACVFRGPYSIPTNDSIEMYNVSVALLWSDGTPTYVSLECNLTKSQ---APEQEA 110 green abalone
Q5PYY2  19 MQMTRGSGINMIRIHYPQPNTSVVPGACVFRGPYSVPTNDSVEMYNVSVAMLWSDGTPTYKSLECNVTKSQAsnAPEPEA 98  black abalone
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap