Conserved Protein Domain Family
DUF3169

?
pfam11368: DUF3169 
Protein of unknown function (DUF3169)
Some members in this family of proteins are annotated as membrane proteins however this cannot be confirmed. Currently there is no known function.
Statistics
?
PSSM-Id: 402807
View PSSM: pfam11368
Aligned: 26 rows
Threshold Bit Score: 89.6872
Threshold Setting Gi: 81675502
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCZ29093      19 K----KAKGTFIAIMCCACLLGGFLGGFGTWLQRGYDKGEAAAWLGERIGTiagnGLPV---------LMVIASAIAfgy 85  Firmicutes bact...
CDC48564       7 EtgrkAGFLQTGILMLIGAIIGG--GGSLVFFCWREPLREELKNLEALIFLysswALIA---------LSVLGCIIG--- 72  Firmicutes bact...
CDA61195       3 K----YPAIKFILITVVSGICGAVLSFLLSFQQAA-----LISAIQSLSRLlg-sALPAlh-----lsVCLFLSGMS--- 64  Clostridium sp....
WP_022132100   3 K----HPVIKYILILIISGSCGALASRIFMNFEDG-----VVGAIKNFSEWfg-sMTPAlh-----isICLFLSLMS--- 64  Negativibacillu...
CDA67447      30 K----KFYWKFIALCGIGGIVGGTAGFLMGFLDDYMAARELSFP-EIFLMVqrnlAIPFr-------yLTVAVGAVFwaa 97  Clostridium sp....
BAM47857       5 K----RDQLKMLKLMGFGAITG--------------------VGLSILFFFvnrvTINFdflieyslyIQIAVVIIFflp 60  Amphibacillus x...
CDD46858       5 K----NSYLRMGIILFCAMLVGGVIGFGGRVMIDSIGEG-IGICMQALIELiqkyMLPLll------iILILTVACG--- 70  Firmicutes bact...
Q2G1V5         1 -----MKILRYIGYLLLGGLVGGIIGGILGNFDGFG-IENLTFATYNNVVVis--------------iVATIIIILVeai 60  Staphylococcus ...
Q5HS11         1 -----MKIKRYALLCLLGGLVGGIIGYIIGAINWEKLFNYAQFANFKVVLYtt--------------iVASLINIILtvy 61  Staphylococcus ...
Q8CY72         7 R----------RLLFLMSIVLGGFLGMFVGMFKARVESHEIILDVKALMPWis--------------aICLLIGFISmfl 62  Streptococcus p...
CCZ29093      86 mAWALKKSKEEWKQAQNYDDEAFEIw-nETSDK--RIGTGLNLVSFVTIFNYFSFSVSFYADIYYDEMSSAMF----LLA 158 Firmicutes bact...
CDC48564      73 -TVLVLRARKKYKNWDREDEEEA-----ERIEK--SYERYQAVISLLSVVGICVSGIVISQLYREEAAGN-------GAA 137 Firmicutes bact...
CDA61195      65 -VFFTSKLRRQIARSNPQNQEELF----EQIESndHCTEILTINTLSVILNFFFLGVSFVYKnpr----------hiLIS 129 Clostridium sp....
WP_022132100  65 -VYSIHKLKKLLNSITPENEDEIY----DQIEN--QSNPGMMCSVLCTISNFFFLGASTAYLipk----------niLIS 127 Negativibacillu...
CDA67447      98 sEYFYRKARKIRKESRDLDEDY------DRIDD--ALNISLLLASVMVIMNFICAGIGFYCLPCAEDMVSF------VIT 163 Clostridium sp....
BAM47857      61 tVYWIQSAKKIINMRDETIDVDDDLh-sEALER--LLYKGLLFNRLYLILNFLSAGLAFDFSNRYF-----------IIS 126 Amphibacillus x...
CDD46858      71 -EVTLNKLRSIGKRMLQAGEEESDQl-eYEEEN--AGGKGMAVNVLSQVLSVIILSAGYSVQ-YIE--NTEKPeg-fLIS 142 Firmicutes bact...
Q2G1V5        61 vLMNQRRALKYKQLVDKEVDIDATDqyeLLANR--YVLNGSILSILQTVIAFLVLLIFVVGHAAAN-------------A 125 Staphylococcus ...
Q5HS11        62 lFIVQNASLHYKAKIDANISDDLADtyeNKSYI--KSLKVRFIYTMQLIVAFIAILIPVIGNASEN-------------H 126 Staphylococcus ...
Q8CY72        63 tFNFLKKSRKFHSLYQEEMDDDLNEtyyVQMYR--NLEFGTIAFNITGVAIPLAIFISLSEVIILHTNPQTFFlsflLFV 140 Streptococcus p...
CCZ29093     159 LVMLIVTIFASVTQQKNAVDFLKIVNPE-KSGSVYDMKFQKKWIESCDEMEQQMIYKAAFHAY-KVTNYLCLTLWTGFTV 236 Firmicutes bact...
CDC48564     138 IHFFVIGAFWNLICLDRIVNYMKKLNPE-RKGNIFSWNYDKECLASCDEREKVQVFHAGYQAY-LKSQYLYLGLFVALVL 215 Firmicutes bact...
CDA61195     130 AAAALLFLTLNTWVEVSHVNMVKRMNPRfEKVDPLSLRFSSQWESKCDEAQKLGMYRAAFRSF-RISQLGFLGAFAVCAF 208 Clostridium sp....
WP_022132100 128 AVATIVFLSINTWVEVSQVNLIKKINPKfKNTDPMSMRFMKDWEKESDEAETFEMYRAGYQSY-KSLRYAFLIAFALCCM 206 Negativibacillu...
CDA67447     164 ISFFLLYVYGSFHMQHVIVNMIKEMNPE-KKGSLYDKKFKKQWYDSCDEAERRQIGIASYHTV-QVTGIACMIFMLIFMM 241 Clostridium sp....
BAM47857     127 ILVFLVTILPGSMNEVKIIRLIQAKDPM-KQGDPTSIKFNKTYFESLDESEKNQVYQVTYHTF-KFMEYTFIVAFGLTLA 204 Amphibacillus x...
CDD46858     143 CILFLICFAYDGMWQVRYIKTEQKIHPE-KKGDPSSIKFQEQWLRSCDEAEKEIIYQSAYKVY-ASLGKCIPVLLLITML 220 Firmicutes bact...
Q2G1V5       126 ILFFLIPFFASAIFNTQFTLFNRRFDD--RIPKIADKNYTEKRLEILDEGERHIELIALFKTY-AINLSILILAIVVIGL 202 Staphylococcus ...
Q5HS11       127 IALIMIPFIITIISSIMIGIFYRKFDA--RYPKLGEKRYTEKAFNIMDEGERYITLVSSYKVH-QQNIVLLFIGIMTLGI 203 Staphylococcus ...
Q8CY72       141 VFLVAQKSLFKTIAIVRQF----------DLEFFATPKDVLNYINSYDEGERQANLEQSFRILfQLHQYVLPALYIFLII 210 Streptococcus p...
CCZ29093     237 LAVVLKISLW-PVTIVSAIWLTMAVSYAAEG 266 Firmicutes bacterium CAG:194
CDC48564     216 LSTILNLGIA-PFLLLLIIWCSQTLIYAYYC 245 Firmicutes bacterium CAG:424
CDA61195     209 TELFYPLGLM-PFLLITVFWGLHSLSFlfac 238 Clostridium sp. CAG:169
WP_022132100 207 IQIFYPIGLA-PFILIAIFWGVHSLSYLSac 236 Negativibacillus massiliensis
CDA67447     242 LGMVIEIGLL-PMLVPAFIWMIQVITYHVSC 271 Clostridium sp. CAG:510
BAM47857     205 LKMYFDMGNA-PMLTVGLLWLIQSIVYFYYS 234 Amphibacillus xylanus NBRC 15112
CDD46858     221 GNLFFNTGML-AILVVAFLWLFVTLTYIRsc 250 Firmicutes bacterium CAG:534
Q2G1V5       203 YSITTGINQSfSLLLIIAIFIYNAFSYLLKR 233 Staphylococcus aureus subsp. aureus NCTC 8325
Q5HS11       204 FSITTGMNQSlGIILFIILFIYNSLGYLLKV 234 Staphylococcus epidermidis RP62A
Q8CY72       211 ISFLTGEIQLlAFLLVGAIHVYINVMQLPMV 241 Streptococcus pneumoniae R6
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap