5UQ1


Conserved Protein Domain Family
Spy1

?
pfam11357: Spy1 
Cell cycle regulatory protein
Speedy (Spy1) is a cell cycle regulatory protein which activates CDK2, the major kinase that allows progression through G1/S phase and further replication events. Spy1 expression overcomes a p27-induced cell cycle arrest to allow for DNA synthesis, so cell cycle progression occurs due to an interaction between Spy1 and p27. Spy1 is also known as Ringo protein A.
Statistics
?
PSSM-Id: 402800
View PSSM: pfam11357
Aligned: 32 rows
Threshold Bit Score: 158.927
Threshold Setting Gi: 645028507
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5UQ1_B        17 DMTAFFKLFDDDLIQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTISEHTRINFFIALYLANTV-EEDEEETKYEIFPWA 95 
Q5IBH6       136 HHKVFTKLLEDPVVKKFLTWDKMLRVSDKYLLSMVIAYFSRAGLFSWQYRPIHFFLALYLANDM-EEDNQAPKQDIFYFL 214 house mouse
EHB09292      52 HQAAFTRLLEDPIVKRFLAWDMNLRASDKYLLAMVITYFSRAGLFPWEYKRIHFFLALFLANEM-EEDSQLQKYDMFFFL 130 naked mole-rat
EHB08993      85 H-EAFTRLLKDPVIKRFLAWDINLKASDKNLLAMVIVYFGRAGLFPWKYQRIHFLLVLYLASDM--ENHQEPKLYTF-FI 160 naked mole-rat
EHB15623      60 HHEAFTKLLEDPVIQGFLAWDINLKASDKNLLATVITYFTQASLFPWQFQRIYFFLALYLANDMeEEDDREPKLHMFFFL 139 naked mole-rat
XP_002723139 122 HHAVFARLLEDPVVKRFLAWDKNLRVSDKYLLAMVVAYFSRAGLFSWQYQRLHFFIALYVASDM-EEDNQASKQAIFAFL 200 rabbit
XP_023615660  78 HHQAFTRLLEDPVIKRFLAWDTNLRLSDKYLLSMVIAYFSRAGLFSWQYQRLHFFLALYLALDM-EENYHAPKQAILSFL 156 little brown bat
XP_005582931 105 HHEAFNRLLEDPVIQKFLAWDKDLRVSDKYLLAMVIAYFSRAGLFSWQYQRIHFFLALYLASDM-EEDNQAPKQDIFSFL 183 crab-eating mac...
XP_014585297  94 HHEVFTTLLEDPVVKRFLAWDRDLLVSDKyllsmviAYFSRAGLFSWQYRRIHFFIALYLANDM-EEDNQAPKQAIFSFL 172 horse
XP_027817348  72 HHMVFNKMLEDHVIKRFLAWDRNLKVSDKYLLAMVIAYFSRAGLFSWQYRRIHFFIALYLASKM-EEDNRAPKQIIFSFL 150 sheep
5UQ1_B        96 LGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRRCCEEVMA----IAPTHYIWQRER 146
Q5IBH6       215 YGKSY-AQRPMFHKLRFQFIRSMGWKIWVSREECEEIQA----YNPDLWVWARDR 264 house mouse
EHB09292     131 YGRNL-AQIPKFQKLRYEFICCMGWNLRVTPEECEEIQA----YDPGFWVWRRDR 180 naked mole-rat
EHB08993     161 SGTNF-DKIPQFHKLRYQFICYISW----TREGCEEIQA----YDPTLWEWA--- 203 naked mole-rat
EHB15623     140 YGMNF-NKIPQFQKLRYQFIRCMDWNLRVTREKCEEIQA----YNPTLWVWg--- 186 naked mole-rat
XP_002723139 201 YGQSR-AQRPLFHKLRLQFIRSMGWQTRVTREECEEIQA----YDPELWVWRRDR 250 rabbit
XP_023615660 157 YGENNCSQRPLFHKLRFQFFRSMGWRARVTREECEEIQA----FDPELWVWKRDR 207 little brown bat
XP_005582931 184 YGKDY-SQRPLFHKLRYQLICSMRWRTWVSPEEMEEIQA----YDPEHWVWARDR 233 crab-eating macaque
XP_014585297 173 YGKNR-AERPLFHKLRLQFVRSMDWRMRVTREECEEIQAfdpdLWV----WGRDR 222 horse
XP_027817348 151 YGRNH-SQRHLFHKLVFQFICSMNWKMRVTQEECEKIQA----FHPRLWVWDRDR 200 sheep
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap