Conserved Protein Domain Family
DUF3157

?
pfam11355: DUF3157 
Protein of unknown function (DUF3157)
This family of proteins with unknown function appears to be restricted to Gammaproteobacteria.
Statistics
?
PSSM-Id: 371487
View PSSM: pfam11355
Aligned: 7 rows
Threshold Bit Score: 225.873
Threshold Setting Gi: 123026225
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q07X26                6 NAIASALFLLLAPAAMAA-----NVAVITLENGANVRLKDDFTWEYIITETvtqpvqaakaDITEQANGVTPPAIAPAAS 80  Shewanel...
WP_011867548          6 QSCAIMALFLLMAPAFAAdkaddAVALITLENGATVRLNADFTWEYVFLTPqantvttepqATTETIQTQTSTEAGQVVA 85  Shewanel...
BAJ04243              8 LSSLALLVFLFPSLAIAAt---eTLARVTLENGAKVRLNDDFTWEYVILE-----------TLPATSSETSPQAVTAITA 73  Shewanel...
Q87KD0               22 KTWITLATLLATSSAYAA-------EVVTLADGREVKLNDDFTWEYVMTSS----------APKEAVAQTTTSAVETVAA 84  Vibrio p...
Q9KVU8               35 KKLILVASIV-SLSTWAS-------ETLQLKDGRYIQLNDDFTWQYV---------------PQETQPQQTSELAPLVLA 91  Vibrio c...
JLExeter:vfu_A00277   2 KNLITLMMASWAPLALAS-------EVVTLQDGRDVQLNDDFTWQYV----------------QPVAPTVQPSDTAVVAA 58  Vibrio f...
Q8EKH9                6 RLSALSSLLLLSSSVMAA-----DVAIITLENGAQVRLKDDFTWEYIITETkaaempvavaAAPSTNIVNTNTAAVAVAP 80  Shewanel...
Q07X26               81 VAAATTPVAAQSvamptapavnsqvattRLTAAALAQPELLGSTAKDGIKITLADTKWKG-DKLGLVFDFDSTSNEHVTV 159 Shewanel...
WP_011867548         86 QAPKVQPVVIASgpv----------vggAMTASAMDHANLLRSTAKGGAKVSYLKSQWDSkGRLGLNFELSSNSEENYVI 155 Shewanel...
BAJ04243             74 IGLNTTSTINLAstsgan-----katsqTMTASAMSQAELLKSTAKSGVKVSFSKAEWDDdGRLGLTFDLASTSSEHYVM 148 Shewanel...
Q87KD0               85 PAIATIPVVTKTv--------------gTTVVVNAKKPTM--QLSDSGVDILIGSASYEG-GELVLPTSITNQSSQSVIQ 147 Vibrio p...
Q9KVU8               92 APVIAQPTLSG-----------------VTITVGDHRPVL--QLSDSGVDVVLSAPRYEH-GQLKLSSAITNQSSQSVIA 151 Vibrio c...
JLExeter:vfu_A00277  59 APVIAAPLVKGQr--------------aSMIELGSDKPTL--QLSNSGIDIVLGSARYRD-GRLVLPTAITNQSSQSVIN 121 Vibrio f...
Q8EKH9               81 VT--------------------------TLTANAIARPELLGSTAKDGIKVSFTDSQWKG-NKLGLTFELASTSGEHVTL 133 Shewanel...
Q07X26              160 VEVEVSFYNDNGALLKTEKLEAWEAIFRMPETYLRKGQHRQSDTIWVEGVNKQQWQKQLISLKIIEIES 228 Shewanella frigidim...
WP_011867548        156 IEMEIGLYADSGELIKTETVNVWQAIFRVPETYLRKGQTRDSETFWIEGIDKARWSKELMTLKIIDMSS 224 Shewanella loihica
BAJ04243            149 IELDISLYDDSGSKLKTETVKVWKAIFRSPDTYLRKGEQRQSRTFWIQGINASQWTKQLLSLKIGEMNS 217 Shewanella violacea...
Q87KD0              148 VEVEVQVFDMSGKQLAKEKVTVWQSIKRMADTYLRPQQAEQGKSIKLAVPQSQQYQ---FSAKVLEVKT 213 Vibrio parahaemolyt...
Q9KVU8              152 VRLAIRVQDAQGVWSEEQEVTIWQSIKRMAETYLRPRTSVEGKPLELNLAEQSQYT---LHATIKQIET 217 Vibrio cholerae
JLExeter:vfu_A00277 122 IELKVEILDEQGQVLATQTSTIWQSIKRMADTYLRPQASVAGKAIEVNVAEAPRYQ---IRVSVNQVET 187 Vibrio furnissii NC...
Q8EKH9              134 VEVETSFFADDGSLLKTEKLGVWKAIFRMPETYLRKGEQRKSRVIWIEGVDKNRWQKQLLNLKITEIES 202 Shewanella oneidensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap