Conserved Protein Domain Family
DUF3152

?
pfam11350: DUF3152 
Protein of unknown function (DUF3152)
Some members in this family of proteins are annotated as membrane proteins however this cannot be confirmed. Currently there is no known function.
Statistics
?
PSSM-Id: 371483
View PSSM: pfam11350
Aligned: 10 rows
Threshold Bit Score: 267.018
Threshold Setting Gi: 81539125
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9CCG9       130 LPDGGAFTEAGDKTWHVVPGTMPQISQSATKVFKYSIEIENGLDPTMFGGDGAFAQMVDQTLANPKGWT--HNPQFAFTR 207 Mycobacterium l...
Q0S2U9       166 LPEGGPFTAVGAGTWHVVPGSGTKIGQGTEREFTYSVEIEDGVDTSGFGGDESFGRMVDQTLSNPKSWT--KDPRFAFRR 243 Rhodococcus jos...
Q5YQX2       213 LPDGGPFTESGAGTWRVVPGTSPEVGAGTEYHFTYTVEIEDGVDTTGFGGDAAVATMVDSTLANPKSWA--HDPKFAFRR 290 Nocardia farcinica
WP_012393217 130 lPAGGPYTQAGDKTWRVVPGTTPQVGQGTGKVFRYTVEVENGLDPTMYGGDDAFAQMIDQTLANPKGWT--HDPQFAFMR 207 Mycobacterium m...
Q4JTR9       100 LPPGGKYTKKGSGKFRTVGEPGKTFGKGK-KKFTYVVEVETTLKSSAYGGDDAFAAMVDATLANPKSWV--GDPQYSFQH 176 Corynebacterium...
Q6NIP8        82 LPSGPEFTQKGEGTYRTVGNAGAHAGKDHDKVFTYVIEVENGINTAAYGGDDAFAAMVDATLTNPKSWT--HDKRFGFEH 159 Corynebacterium...
Q8FRH3        82 LPPGGPFTQEGEGSFRVVGNPLPPVGEG--RVYTYIIEVENGIDTAAYGGDDGFVSVVDATLANPKGWI--ANPDYAFQH 157 Corynebacterium...
Q8NSA6        73 lPPGGSYTETGAGTFRQVGAALPRVGEGQEQTFTYVIEIEDGVNTAAYGGDDAFVAAVDATLSDPKGWT--ADPAFAFEH 150 Corynebacterium...
Q9FBI6       370 TYP-LGATLKASGKFDAVPGIAKGTGKG--QKYTYRIDVEQGLGLDG----GLFAEAVQKTLNDDRSWA--HNGARTFER 440 Streptomyces co...
CAM00401     114 LPPGAPVPEFGARTFEVLPGTSPRIGQG--DLYRYTVEVEVGVKLSE--GNDSFGNLVQETLSDPRSWTnpQAGGIALER 189 Saccharopolyspo...
Q9CCG9       208 IDTGM------PDFRISLVSPLTIRAGC---GYEFRLE-TSCYNPSfgpdrQARVLINEARWLRGALPFEGDVGSYRQYV 277 Mycobacterium l...
Q0S2U9       244 VDQGD------PDFRVSLTSQMTIREAC---GYDIQLE-VSCYNPG-----IDRVVLNEPRWVRGAIAFQGDIGSYRQYQ 308 Rhodococcus jos...
Q5YQX2       291 IDAGN------PDFRISLTSRQTTRTAC---GFEIPID-SSCYNAD-----LDRVVLSEARWVRGALAFEGDIGSYRQYL 355 Nocardia farcinica
WP_012393217 208 IDTGK------PDFRISLVSPVTVREGC---GYEFPLE-TSCYNPSygpdrQARVFINEARWVRGAVPFEGDIGSYRQYV 277 Mycobacterium m...
Q4JTR9       177 VDEKKlpkgkePDMRIQLTSPETTAATC---GDSYGIE-TSCNYPG-----ERRVVLNEARWVRGAIPFEGDLGAYRQYM 247 Corynebacterium...
Q6NIP8       160 VDAGAvk---dPDLRIQLSSVDTTHGLC---GNNIAME-TSCFYGI-----GNRVVINESRWVRGAKPFQGDLGAYRQYL 227 Corynebacterium...
Q8FRH3       158 VRPDEd-----PDLRIQLSSLATTHALC---GNDIEME-TSCFYSD-----GNRVLINESRWIRGALPFDGDLGSYRQYL 223 Corynebacterium...
Q8NSA6       151 ISGDEd-----PDLRIQLTSLSTTHELC---GNDIEME-TSCFYSD-----GGRVMINESRWIRGAAPFKGDLGSYRQYL 216 Corynebacterium...
Q9FBI6       441 VESGQ------PDFVITLASPGTTAEWCaksGLDTTEDnVSCDSAA-----TQRVMINAYRWAQGAAPYGDAIHAYRQML 509 Streptomyces co...
CAM00401     190 VDRTGq----rPDFRVILVSQQTAREACd-fSNGVPFD-SSCRK-------GDMVYINAARWVRGAVSFEGDSGSYRRYA 256 Saccharopolyspo...
Q9CCG9       278 INHEVGHAIGYVRHEPCDKQGGLAPVMMQQTFSTSNNDGAKF----DPEWVKP-DGKTCRFNPWPYP 339 Mycobacterium leprae
Q0S2U9       309 INHEVGHAIGYQDHQPCETEGGLAPVMMQQTFGTANNDIAQL----DPEGIVPmNGLTCHFNPWPFP 371 Rhodococcus jostii RHA1
Q5YQX2       356 INHEVGHAIGYHQHQPCETDGGLAPIMMQQTFGTDNNAIAAL----DPDGVVPmDGKRCRFNPWPYP 418 Nocardia farcinica
WP_012393217 278 INHEVGHAIGYLRHEACEKPGGLAPVMMQQTFSTSDDEAAPF----DPEFVKA-DGKTCHFNPWPYP 339 Mycobacterium marinum
Q4JTR9       248 INHEVGHGIGHKAHVPCSKDGALAPIMMQQTISLNNAEIYKI----NPDKAFKgNSNTCKVNPWVFP 310 Corynebacterium jeikeium K411
Q6NIP8       228 INHEVGHGIGFANHEPCGKNGELAPIMMQQTLSLSNSELFAI----DANETYNdDGAVCSANPWPYP 290 Corynebacterium diphtheriae
Q8FRH3       224 INHEVGHGLGYAAHDHCAADGELAPIMMQQTLSLNNSELYRI----DPDEVYPdDGATCVYNPWPYP 286 Corynebacterium efficiens
Q8NSA6       217 INHEVGHGLGYAAHDACTAPGELAPIMMQQTLSLNNSELFRI----DPDEVYPdDDATCEFNPWPYP 279 Corynebacterium glutamicum
Q9FBI6       510 INHEVGHRIGY-NHVTCDKDGELAPVMQQQTKFVDH------------------DGIDCRPNAWAYP 557 Streptomyces coelicolor
CAM00401     257 INHEVGHVFGN-GHIGCPAQGGLAPVMMQQTFSVSNNELHELnkvaDQGTFIPaNGFVCKYNAWPFP 322 Saccharopolyspora erythraea ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap