Conserved Protein Domain Family
DUF3148

?
pfam11347: DUF3148 
Protein of unknown function (DUF3148)
This family of proteins has no known function.
Statistics
?
PSSM-Id: 402792
View PSSM: pfam11347
Aligned: 43 rows
Threshold Bit Score: 89.5662
Threshold Setting Gi: 427344964
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EDQ58810                   88 GSAVVVTEAPPLLKTAEPMPMMRPNNgLINVGDAGRVIDRRPKDTWAVRFAVGSYLIDRKYF 149 Physcomitrella patens
Q7NJB8                     31 GQKVRLVRVPPYVKTADAMPMLRSSA-FLEVGQEGLILDRRPGNYWAVRFKQGAFLIDGGDL 91  Gloeobacter violaceus
XP_002966959                2 GTPVVVTEAPQILKTAEPMPMLRKNDgVIRPGDVGRIIDRRPKNVWAVRFAIGAYLIDGKcf 63  Selaginella moellend...
NP_568406                  49 GSPIIIVEAPKVIKTAASMPCLRANSgLVKPGDVGRIVSRKPKDLWAVRLSIGTYLLDGKYF 110 thale cress
XP_006367580               46 GSPIIVIESPKLLKTAASVPCLRPNVgLVKPGDVGRIVSRKPMDVWAVRLSIGTYLIDRKYF 107 potato
BAG86977                   62 GSPIVIVEAPVMLKTAASVPSLRHNAgQVKAGDVGRVMARKPKDVWAVRLAIGTYLLDGKYF 123 Japanese rice
XP_009412500               51 GSPIVVVEAPPTLKTATAMSSLRINAgLVKQGDVGRIIARKPKDVWAVRLAIGTYLIDGKYF 112 wild Malaysian banana
ERM93611                   53 GSPIIFVEAPPTLKTADSMPSLKINNgFVKPGDVGRIVARKPKDVWAVRLTIGTFLMDAKYF 114 Amborella trichopoda
dbpsupku:SYNPCC7002_A0855   7 GTQVKLTQLPPYLKTADPMPMLRPAD-LLAVGAVGTLGDRRPGGYWAVKFERGSFLLEETYL 67  Synechococcus sp. PC...
WP_015162500                8 GATVKIIALPPYLKTADPMPMLRPPT-LLEIGAEGIIIDRKPGNYWAVKFDRSSFLLEDRYL 68  Chamaesiphon minutus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap