Conserved Protein Domain Family
DUF3149

?
pfam11346: DUF3149 
Protein of unknown function (DUF3149)
This bacterial family of proteins has no known function.
Statistics
?
PSSM-Id: 402791
View PSSM: pfam11346
Aligned: 30 rows
Threshold Bit Score: 25.5454
Threshold Setting Gi: 123628115
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003440470     52 VTQpISNEAGLIaAVIVITLVILMVLGFIVYYIRKMLKAKE 92  Nile tilapia
hku:LHK_01715     5 KEL-LSSEVGIM-SLIVIAIAFIVPIYCVRYFMRKSHEDPC 43  Laribacter hongkongensis HLHK9
jgi:Msip34_0279   3 KVL-FGSWVGIA-SIMTIVLTIVVVSYWVGYCVVNANRAK- 40  Methylovorus glucosetrophus SIP3-4
tigr:AHA_1050    17 MNLmFGNSVGLM-SMLVIIGTFLLISSYAAYFIYKVMNAKP 56  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Q6LNC8            5 LDLlFGNAVGLS-SMIVIFITLGLMLFFGGYFVYKVLSAPS 44  Photobacterium profundum
OXX60065          5 LDLlFGNAVGLS-SMIVIFGAFGLMLFYGGFFIYKVMNDKS 44  Vibrio sp. V15_P4S5T153
Q8EAL1            5 LDLmFGNPIGLL-SMIVIFSTIGIISYITWLFIMKSAPQS- 43  Shewanella oneidensis
jgi:Sama_0549     5 LDLmFGNPIGLM-SMIVIFTTLGIISYIMWMLFVKSAKP-- 42  Shewanella amazonensis SB2B
Q088E7            5 LDLmFGNAIGLL-SMTVIFCTFGIMSYLMWMFIVKSAPTK- 43  Shewanella frigidimarina NCIMB 400
IBRC:GU3_13630    5 LDLmFGSDVGFM-SMMVIIATTLLISFYAGYFVYKVMKSDP 44  Oceanimonas sp. GK1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap