Conserved Protein Domain Family
DUF3142

?
pfam11340: DUF3142 
Protein of unknown function (DUF3142)
This bacterial family of proteins has no known function.
Statistics
?
PSSM-Id: 371478
View PSSM: pfam11340
Aligned: 7 rows
Threshold Bit Score: 320.562
Threshold Setting Gi: 257048050
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8EBB6            142 DPRPKVAVIRLDGQLTRLNNHQVISKISELVKEWQAQGTVIAGIEIDHDSASSKLAAYNAFLRQLKSQIPNTLKLSITAL 221 Shewanella...
jgi:Psefu_3967     83 DGRPVVMVIRLDGQLPQPDQTQILSRTASLLAEWQASGVNLQGVEIDHDCASARLPAYTDLLTALRSALPANLALSITAL 162 Pseudomona...
Q4K3C1            122 DGRPLIAVVRLDGQLPSLNQDDILQQVQQLLADWQGQGLTLAGLEIDHDAGSARLPAYAGLLRRLREVLPQQLALSITAL 201 Pseudomona...
BAN46632           83 DGRPLIAVVRLDGQLPALDLPRARADILALLADWRAQGLAVRGLEIDHDCASARLPGYARFLGELRQALPAELQLSITAL 162 Pseudomona...
WP_024912305       87 DGRPLWLVVRLDGQLKQLDETVIRQRLLQQLQRWQAAGLTVVGVEIDHDAAVARLPAYQHFLQQLRQQLPTSLQLGITAL 166 Chania mul...
bbmufp:Hsero_3746 117 TGRPLLMTVRINGQLARLDAAAIQDHLLERLSAWRRRGLQPAALEIDYDCATARLPEYIAFLRSLKARVAP-LDLAVTAL 195 Herbaspiri...
jgi:CAP2UW1_3993   83 SGRPAIPVVRIAAPLATLDGATLIADLVTLRGDWPTS----ATLEIDHDCGSRQLADYTRFLVALRRALPPGQRLSLTIL 158 Candidatus...
Q8EBB6            222 PAWLSSTEFPSLFEHIDELVLQIHSVSDPRLGLFDATQGWQWVEQLSRLAKVSYLIALPSYGSAV-YSTTSDy-rVESEV 299 Shewanella...
jgi:Psefu_3967    163 PTWLNSPHLEALLRQVDSSVLQVHAVNDPRDGLFDPQQAQRWADAYGKRSAKPFLLALPAYGVAV-IGTSGQ---VESEA 238 Pseudomona...
Q4K3C1            202 PAWLDSRELPGLLAQVDSSVLQVHAVSDPRRGLFDPHQAEQWARRWAGVSDKPFYLALPAYGVAL-LPGTAQapvVESEA 280 Pseudomona...
BAN46632          163 PAWLDSPELPGLLRQVDSSVLQVHAVSAPADGLFDPTRALAWARRWNSLSERPFQLALPAYGIAL-VAGK-----VESES 236 Pseudomona...
WP_024912305      167 PAWMDSPALSGVLQQTDSSVLQVHAVLSPQQGLFDGPLALRWASQYARISTKPFRVALPAYGMGL-VGIDAQgaqVESEV 245 Chania mul...
bbmufp:Hsero_3746 196 PTWLSSPQLASLLAVADESTLQVHAVLDPRLGLFDARLAQDWLHQYAQRTRRPWHVALPAYGARVsWDAQGRiaaVESER 275 Herbaspiri...
jgi:CAP2UW1_3993  159 PDWLGAPELDDLLATVDEAVLQLHSLDKPARRLFDAVGARAWTASLARRTDKPFRVALPNYGSRVvLDGQGRiaaVESEV 238 Candidatus...
Q8EBB6            300 PLRMplaetssqHLTRQELMADPEVLQSFVKKLHTLADPNLRGMIWFRLPLE 351 Shewanella oneidensis
jgi:Psefu_3967    239 PLDV--------RGSRRELHADPQQVANLLSTLEERRPEKLRGIIWFRLPLP 282 Pseudomonas fulva 12-X
Q4K3C1            281 PIAR--------RGQRRELMADPEQLSQLAKTLRNDPPAHLAGLIWFRLPLK 324 Pseudomonas protegens Pf-5
BAN46632          237 PLAI--------AGPRRELQADPQQLAELLEQLRRQRPEHLAGVIWFRLPLA 280 Pseudomonas resinovorans NBRC 106553
WP_024912305      246 SLRV--------AGATQELSVAPQQVADFLRQLAARKLPRLQGIIWFRLPLA 289 Chania multitudinisentens
bbmufp:Hsero_3746 276 PLLA--------GGLGNELMVDPQVMARFVAQLQASPPAGMAGITWFRLPTG 319 Herbaspirillum seropedicae SmR1
jgi:CAP2UW1_3993  239 PLAAgqv--gegPGEGRELFVAPATVAAFLRWLEKASPRQLAGVVWFRLPLA 288 Candidatus Accumulibacter phosphatis c...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap