Conserved Protein Domain Family
DUF3129

?
pfam11327: DUF3129 
Protein of unknown function (DUF3129)
This eukaryotic family of proteins has no known function.
Statistics
?
PSSM-Id: 402776
View PSSM: pfam11327
Aligned: 156 rows
Threshold Bit Score: 95.3849
Threshold Setting Gi: 528294474
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_006665260  15 SAHGLVTMIKG-DNG-VMMPGLGVT--DG--------TPRDCSS-NGCGS---QA--DTS------II--------RNRD 62  Cordyceps milit...
CCU79685      27 nearaVQNIKG-DDTvPNTSGSNIR--DGs-------VPRLNEV-KSLLF---TR--DGA-------------------- 70  Blumeria gramin...
CCU79858      26 MAE-----VDG-------SAGLESQ------------AIVDGSN-PPAEMtdmAEmaDTTemadtpEMndmtnntnNEDA 80  Blumeria gramin...
EGX51782      21 YGHGLIVDAYGnANAkARGRGLGFIdqYN--------GNRWGTA--QHPF---QV--DVP------VF--------KDPI 71  Arthrobotrys ol...
XP_011107730  21 nGHCVIIDAVGnAPTsSHCMGMGAD--PS--------TPRNGVT--QPGF---QE--DTP------VF--------ASPA 69  Dactylellina ha...
XP_011126334  20 SGHVAIIGARGdQERaVNGQAFGITsqTHvlydgklvGFRSGDA-RWP-F---QK--DTT------VF--------ASPA 78  Arthrobotrys ol...
XP_011123401  18 lSHVLVTNAFGnVDPtAKTYGIGLL--EN--------TNRQNGA-RFN-N---QR--DVT------VF--------SDPT 66  Arthrobotrys ol...
EPS38760      17 LSHCLITDSYGnANPnIKGYGLGLL--EN--------TNRGSDS-RVD-G---QR--DCT------IF--------SNPA 65  Dactylellina ha...
XP_011117191  17 FSHCLITGAYGnANHkIRSYGIGLL--ED--------TNRRVDS-RVD-G---QR--DCT------VF--------SDPA 65  Arthrobotrys ol...
CCU83140      17 SGKSVIVRAVE-DVG-KKKSAISNE------------QPHSIEYaVHKSV---QE--DVTrsnignLY------------ 65  Blumeria gramin...
XP_006665260  63 M----QQ-------------------------------------------------NPLGKTq----------------- 72  Cordyceps milit...
CCU79685      71 --------------------------------------------------------ATLNNAd----------------- 77  Blumeria gramin...
CCU79858      81 TssdnNG------------------------------------------------------------------------- 87  Blumeria gramin...
EGX51782      72 VpccnKPrty--------------------------------------------laTGCGITlqiiwrnnirdnkhlvhq 107 Arthrobotrys ol...
XP_011107730  70 VpwtkPKcqgydpkrgascckgsk----------------cwpktyysavkrvhvpSGCGVTl----------------- 116 Dactylellina ha...
XP_011126334  79 VpwklPGcwldkkgkkvchk-----------------------ekylvpvrrkyfdGGCGVTlhtvgqyakyrdalwnte 135 Arthrobotrys ol...
XP_011123401  67 MapngSGqaknagdkwyckkcpiydqeckhckgvtdckkcfigydpncsacrkrnlSGCGRTy----------------- 129 Arthrobotrys ol...
EPS38760      66 MtpngSGakdpqckkcpagfdiqcakckg-----vkgcrlcplydtncpqcrqrdlNGCGRTy----------------- 123 Dactylellina ha...
XP_011117191  66 MtpngSGarqrkctlcpagfdtecgacrg-----vkncqkcplydtncskcrkrhlPGCGRTy----------------- 123 Arthrobotrys ol...
CCU83140      66 ---------------------------------------------------------SCGENs----------------- 71  Blumeria gramin...
XP_006665260  73 ----------------GT-----------------------------------G--PVDAAVNVAAFMgtsknapknnga 99  Cordyceps milit...
CCU79685      78 --------------------------------------------------------NANNAENPENID------------ 89  Blumeria gramin...
CCU79858      88 --------------------------------------------------------AVPDENSIRMSE------------ 99  Blumeria gramin...
EGX51782     108 ---------------------------------------swyapavqslftskrgyQLDMNYEKNLIV------------ 136 Arthrobotrys ol...
XP_011107730 117 ----------------GRlkgsakrnhpvqyaqpwnqntfknvyyyqqpvpgdA--WINTSDEINQRV------------ 166 Dactylellina ha...
XP_011126334 136 kavhrtakffqqpvkpGA--------------------------------------MVNVSLELTHSI------------ 165 Arthrobotrys ol...
XP_011123401 130 ----------------YVgsakyyitdspq------------lrgtdsnfpsyNtaRLNTTSWLEWMV------------ 169 Arthrobotrys ol...
EPS38760     124 ----------------YTsgskyyvidrpe------------lkgtdpnnplyNsgYIHTANWIEWMI------------ 163 Dactylellina ha...
XP_011117191 124 ----------------YAssskyyvvdhpe------------lkgtdparpfyNsaYIHTANWIEWLR------------ 163 Arthrobotrys ol...
CCU83140      72 ----------------KA-----------------------------------G--SNEPSDVLIKLF------------ 86  Blumeria gramin...
XP_006665260 100 sagvgqeddlsglpagaakrheerknmvrglfgdllggaaggagaaggaaggaagglggllggaggaggaaggaagglgg 179 Cordyceps milit...
CCU79685         --------------------------------------------------------------------------------     Blumeria gramin...
CCU79858         --------------------------------------------------------------------------------     Blumeria gramin...
EGX51782         --------------------------------------------------------------------------------     Arthrobotrys ol...
XP_011107730     --------------------------------------------------------------------------------     Dactylellina ha...
XP_011126334     --------------------------------------------------------------------------------     Arthrobotrys ol...
XP_011123401     --------------------------------------------------------------------------------     Arthrobotrys ol...
EPS38760         --------------------------------------------------------------------------------     Dactylellina ha...
XP_011117191     --------------------------------------------------------------------------------     Arthrobotrys ol...
CCU83140         --------------------------------------------------------------------------------     Blumeria gramin...
XP_006665260 180 llgglggggggtksnlaaesmvadtagMGS-TQGMPTSD-----S-TGTVSLVYRQI------NQ---DGAG-PLTAAVD 242 Cordyceps milit...
CCU79685      90 ---------------------------ATNrDKQIPQVSklvtgPdDKSITVDSHMImmtvkaNE---NGVG-SYMCMID 138 Blumeria gramin...
CCU79858     100 ---------------------------SIDgAPGFPMIA-----A-GGLVTLSLKA-------TA---DKSG-PFTCMID 135 Blumeria gramin...
EGX51782     137 -----------------------------S-KKLMPQAT-----A-GGWMKIRIHQV------NI---DGAG-PYRCRID 170 Arthrobotrys ol...
XP_011107730 167 -----------------------------N-TNSMPVVT-----A-GGWLKLTLHQI------NS---DGGG-PFACTLD 200 Dactylellina ha...
XP_011126334 166 -----------------------------K-IDKLTTAA-----A-GGFIKMTMHEV------NKtvvEGSGgGFRCFVD 203 Arthrobotrys ol...
XP_011123401 170 -----------------------------D-RNLVAKVT-----A-GGWVNVTMSQQ------NT---DGGG-PYMCQLD 203 Arthrobotrys ol...
EPS38760     164 -----------------------------G-EGKVPQVT-----A-GGWLWINMFQQ------TT---DGAG-PYTCRLD 197 Dactylellina ha...
XP_011117191 164 -----------------------------E-KGKIPIVT-----A-GGWLWVTMFQQ------TT---DGAG-PYYCMLD 197 Arthrobotrys ol...
CCU83140      87 -----------------------------AdSDSIPMVS-----A-GGMVTIKLQST------ESqv-----ePYKCMID 120 Blumeria gramin...
XP_006665260 243 GTSG--GTDASAF--Q-QA-EVTKDVPGLg---iGGLSLATNTDFPLQVKMPAGMTCEGT------VGGVKNVCIVRVRN 307 Cordyceps milit...
CCU79685     139 STGT--GTSAGIWteMeVTsKSTDKIS-----------PDGVADVEIQAAIDPNQKCTGR------LDDKENVCVVRCSD 199 Blumeria gramin...
CCU79858     136 SMAD-------NLdsLtNMeIVVNSInq--------daTSDKTEVSLSAQIPADQSCLGN------MNDTDNVCTIRCDN 194 Blumeria gramin...
EGX51782     171 QTGTanSFGQWLWp--------tQNMPGNkysf--nvgTIHKPNNWIHLPIPAGIRCGGT------AGPYKNVCIIRCEN 234 Arthrobotrys ol...
XP_011107730 201 PAAAggSFPIK-L-------KVTTNVPGNay-siNKYS---LKKWPIVIQIPAGIQCQGS------FGGQNNICIVRCQN 262 Dactylellina ha...
XP_011126334 204 STGLg-RTFPTRL----------KLTPGAlpagvKPN-KEGTKQWHMMVYLPTSLDCKGS------HNGRKSICIIRCQD 265 Arthrobotrys ol...
XP_011123401 204 ET----GTG-ENF--K-PLdIVGKDCAGR-----YGANLCKNQDWYVGAILPKDLNCKGTtigekkTDVLEKICMLKCYN 270 Arthrobotrys ol...
EPS38760     198 RT----GTG-FQW--E-KL-TVPVETVGV-----QGANPCQNINWVWPLQMPDDLECTGT------NGNTKNICIVRCQD 257 Dactylellina ha...
XP_011117191 198 QA----GKG-EEW--V-NM-TVPVVSPGI-----QGASPCNNQNWEWPLKLPQDLKCTGE------YGALKNVCLAKCFN 257 Arthrobotrys ol...
CCU83140     121 ST----GTGSGDW--S-DM-EVVTNVP-------DKTTSSKEAYNSLNAKIAPDQRCTGS------VAGVGNVCMIRCND 179 Blumeria gramin...
XP_006665260 308 SAAAGPFG 315 Cordyceps militaris CM01
CCU79685     200 AATPGsle 207 Blumeria graminis f. sp. hordei DH14
CCU79858     195 IAtptvig 202 Blumeria graminis f. sp. hordei DH14
EGX51782     235 QAVNGPFG 242 Arthrobotrys oligospora ATCC 24927
XP_011107730 263 KARNGPFG 270 Dactylellina haptotyla CBS 200.50
XP_011126334 266 RSEDGPFG 273 Arthrobotrys oligospora ATCC 24927
XP_011123401 271 DAPNGPFG 278 Arthrobotrys oligospora ATCC 24927
EPS38760     258 DAPNGPFG 265 Dactylellina haptotyla CBS 200.50
XP_011117191 258 DAPNGPFG 265 Arthrobotrys oligospora ATCC 24927
CCU83140     180 AVQSGshe 187 Blumeria graminis f. sp. hordei DH14
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap