Conserved Protein Domain Family
DUF3126

?
pfam11324: DUF3126 
Protein of unknown function (DUF3126)
This family of proteins with unknown function appear to be restricted to Alphaproteobacteria.
Statistics
?
PSSM-Id: 402773
View PSSM: pfam11324
Aligned: 38 rows
Threshold Bit Score: 68.7741
Threshold Setting Gi: 303300059
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2RSW2                            5 EIRKVEAYLRRTFATEALTLTPPPKAGgSCEVLLKGEFIGTLNRDEDEGEVSYAFNMViLDLD 67  Rhodospirillu...
dbos:1099484000104_PB2503_08014   5 ELDKLSRFLKARFRSETVTLKAVPGQG-AAGVYDESEFLGLLTRDEDEGEISFDFVMR-LPAE 65  Parvularcula ...
ACI99215                          5 EIARLQAYLRKTFGNDRLTVMAPAKKGqPVEVMLGEEFIGTLYRDEDEGDVSYNFNMSiLSED 67  Rhodospirillu...
WP_003616619                      8 EISRLQTCLRRLLGSPGLTVNAPPRAGlSVELAVNGEVVGTIHRDEDEGEVSYAVHMTvLEED 70  Acetobacteraceae
Q5FNR8                            8 EVTRLQTTLQRLLGSPKLTVNKPSRKGmSVELAVAGEVIGTVHRDEDEGEVSYAIHITvLEED 70  Gluconobacter...
WP_012812599                      9 EISRLQTALRRLLGSEKLTINPAPRAGmSVELAADGEVIGTIHRDDEDGDVSYAVNIVvLEED 71  Acetobacter
Q0AQS6                            9 EAAKLQMFLQAKL-NPEMVVQCRNRPDeCAEIHIGDECLGVVAKIIDEGETSYSFEITiLDID 70  Maricaulis ma...
jgi:Hbal_0639                     5 ESKKVEAYLQKTL-NPAINLKARPKTPdSVEAYLGDEFIAVIYKDEDEGEIAYQLNMTiLPED 66  Hirschia balt...
Q0C143                            5 ETLRLEAYLKEKL-HPGLRLLARQKTDdSVEVYLGAEFIAVVYKDEDEGETSYQFMMTvLKED 66  Hyphomonas ne...
WP_014103101                     14 ESSKIQKFLEKTLKTPGLALRARPQAAdSVEVLVNGEYVGLIHKDLDEGETSYIFTMTiLDID 76  Micavibrio ae...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap