Conserved Protein Domain Family
Med30

?
pfam11315: Med30 
Mediator complex subunit 30
Med30 is a metazoan-specific subunit of Mediator, having no homologs in yeasts.
Statistics
?
PSSM-Id: 402766
View PSSM: pfam11315
Aligned: 12 rows
Threshold Bit Score: 177.562
Threshold Setting Gi: 156399435
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
OCA32617      33 NTASLCRIGQETVQDIVFRTMEIFQLLRNMQLPNGVtyHTVTYQDRLGKLQEHLRQLSILFRKLRLVYDKCNENC--AGL 110 tropical clawed...
XP_002585724   6 NTASLCRIGQETVQEIVSKTQEVFGLLKTWQLPNGV--NPNIHQERQTKLQDLVRQMEVLFRKLRLIYEKCHEST--AGL 81  Florida lancelet
XP_026805820  71 NTASLCRFGQETVQEIVSRTHEVFQILKVLMPPNGTptGANMSNERRIKMQDQLRNIKLLFKRLRIIYEKCNDSCqlQGM 150 corn leaf aphid
EFX81650      38 NPASLCRFGQETVQELVSRVQECFQLLKNLQPPNGSaqSTSVAVDKKNKLDDQLKMVKVLFKRLRIIYNKCNENS--QEL 115 common water flea
EFA08543     146 NTASLCRIGQETVQDIVSRTQEVFQTLKTIQPPNGTpqSSNASNEKKAKVQEQLRTIRVLFKRLRLIYEKCNENCqlQGM 225 red flour beetle
Q172Y1       158 NLLTLCRIGQETVQDIVSRFQEVFGLLRGIQPPNGTnaGLSSSNDKKAKVQEQFRTIRLLFKRLRLLYDKCNDNCq-QGM 236 yellow fever mo...
Q9W0P3       178 NIVQLSRLGQETVQDIASRFQEVFASLKGIQP------TSHRENSSEKKVQEYFRTIRLLFKRVRIIYEKCND----AGM 247 fruit fly
Q4V8V8        45 SPVYLCRIGQETVQDIVTRTMEIFQITRATQLPNGVtqSQAAYQDRFGKLQEHLRQLTLLFRKLRLLYERCVEMT--SDL 122 zebrafish
XP_001638507  47 NPITLTIQGQRTVQEIADKAIELFRKLQNARLSTDT--TSRQSQAQTKDIRDQLNTLKGLLAKLRNVYNDTKRAVtiPAG 124 starlet sea ane...
XP_790489     17 NAASLCRLGQETVQDLVTETQDMFSNLKGVQLPNGRsnTQQSHQDKITKLQDITKHIEVHFKKLRLLYDKCIQIS--SGV 94  purple sea urchin
XP_002126655  18 NPVSLYQAGQDIVQDIAQKAQEIFQALKLSQLPNGIatGQRNAQERINKLKDLLNKVEVLFKQLRVIYNECQKRV--GDV 95  vase tunicate
XP_029023381  29 NTASLCRIGQETVQDIVLRTMEIFQLLRNMQLPNGVtyHPNTHQDRLGKLQEHLRMLSVLFRKLRLVYDKCNENC--AGL 106 Siamese fightin...
OCA32617     111 D-----PVP-IEQLVPYVE--EE-YSKHDDRGiASQLRFASEEKREILEvnkKLKQKNQQLKQIMDQLRNLIWDINSMLA 181 tropical clawed...
XP_002585724  82 Q-----HSN-IEALVPYVE--HL-EGKHEDSE-SDSVRYVNEERRDVVE---VIKQKNQQLKVLMDQLRELIWDVNAMMV 148 Florida lancelet
XP_026805820 151 E-----YMH-IEGLIPLQE--EW-DMKSEERKtSETYRVASDEMKEVAE---QLSNKNRHLKEIIDHLRRIIWEINTMLA 218 corn leaf aphid
EFX81650     116 D-----SYP-LDSMLPTQS--NLvDWKYADRVkSEQYLTAVDEKKELYD---QILVKNRHLQDIMEYMRSIIWEINTMLM 184 common water flea
EFA08543     226 E-----YTH-IESLIPFKD--EH-DPKHDEKKnSEAYRLACEECKEVME---QVILKNKQLKDVIDHLRRIIWEINTMLT 293 red flour beetle
Q172Y1       237 E-----YTH-VESLIPLKG--EP---ERAEPIhTEEYKKALQENRELIE---IVMLKNKQLREIIDKIRLTIWEINTMLS 302 yellow fever mo...
Q9W0P3       248 D-----YMS-AESLIPYRD--EP--EPRIEPSlCDEYRKVLQENHELIE---TVKLKNRQLREIIDRTRIIIWEINTMLA 314 fruit fly
Q4V8V8       123 Q-----ETP--AELVPYVG--EEvSAVRVELCsPA----VLQERQEVLE---KVRQKNQEMKMLMDQMRNLLWDVNAMLT 186 zebrafish
XP_001638507 125 En--------VENLIPLE------CSPRNEMDtSDGGGPVEQERAELQK---KLKEKNDQLKEVIDKLRIAVWDINTMIM 187 starlet sea ane...
XP_790489     95 HtasgtHTP-SEDLIMWKD--VIsSKDLIALGsREKAQYLNDKRLHLME---QLQAKNRQLRQVMEQMRHLMWDINTMLA 168 purple sea urchin
XP_002126655  96 E-------PnVNTLVPILKegEIpNTEHEQALkSHKELVLQSRKKDLEM---KLCMKNKQLETLVAQMTDFVWDINAALa 165 vase tunicate
XP_029023381 107 D-----PIP-PEQLIPFVE--DD-GSKHEDRS-AGQSRPATDERREILEvnkKLKQKNQQLKQIMDQLRNLIWEINSMLA 176 Siamese fightin...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap