Conserved Protein Domain Family
DUF3117

?
pfam11314: DUF3117 
Protein of unknown function (DUF3117)
This family of proteins with unknown function appears to be restricted to Actinobacteria.
Statistics
?
PSSM-Id: 371461
View PSSM: pfam11314
Aligned: 19 rows
Threshold Bit Score: 76.9644
Threshold Setting Gi: 528325216
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_013349509              4 MKPRTGDGPMEVAKEGRSLILRLPIDGGGRLVVELNNDEATELRECLLKV 53  Micrococcaceae
WP_009357720              4 MKPRTGDGPMEVTKEGRSLIMRVPLEGGGRLVVELNAAEAANLKECLVGV 53  Micrococcaceae
Q6AA22                    4 MKPRTGDGPMEVTKEGRGIIMRVPVEGGGRLVVELNADEAQELLACFKDV 53  Cutibacterium acnes
jcvi:HMPREF9154_1177     28 MKPRTGDGPMEVAKEGRGIVMRVPVDGGGRLVVEMNATEATDLLNALRGV 77  Pseudopropionibacterium propionicu...
bcmhgsc:HMPREF0573_10165  4 MKPRTGDGPLEVTKEPRCNVMRIPADGGGRLVIELNDEEVATLAKELEKf 53  Mobiluncus curtisii ATCC 43063
cebbi:ckrop_0637          4 MKPRTGDGPMEAVEEGRKIVMRIPTDGGGRLVVELNHEEAGELASVLSEA 53  Corynebacterium kroppenstedtii DSM...
Q6NHZ3                    7 MKPRTGNGPMEAVFESRKIVMRIPTDGGGRLVIEMNKEEAAELGALLTEV 56  Corynebacterium diphtheriae
WP_010187237              4 MKPRTTGGEMEAVEESRKIVMRIPSDGGGRIVIELSKEEAAELGSLLVAV 53  Corynebacterium
CeBiTec:B841_05290        4 MKPRGVNGPMEAVVENRKIVMRIPSDGGGRLVVELSQEEASELGGLLLEa 53  Corynebacterium maris DSM 45190
WP_013138506              4 LKPRTGDGPLEVAKEGRGIILRMPVDGGGRLVVELSVQEATALSEALAGV 53  Segniliparus rotundus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap