Conserved Protein Domain Family
DUF3103

?
pfam11301: DUF3103 
Protein of unknown function (DUF3103)
This family of proteins with unknown function appear to be restricted to Proteobacteria.
Statistics
?
PSSM-Id: 402754
View PSSM: pfam11301
Aligned: 9 rows
Threshold Bit Score: 508.151
Threshold Setting Gi: 117562946
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7MFN8         66 KRELAKQLGENYSSVESTLRQNINAQQLNVPISTLVEQ-KPQAQ---MSRRFVQADEQIRTWKGVSEYTDELLEVRLANE 141 Vibrio vulnifi...
WP_012603757   41 KQSLALQISERYSDLELSLKAQISEKNLSAPVDKLSST-QPYSA---FSSRMQKADLGYRKMKGINDFSDSVLEVRMADE 116 Vibrio tasmani...
Q87RX7         63 KRELAQQLSENYTAIEPMLRRDITAQQTNVPVSSFIEQ-NPTAE---FSQQLVEADAQIRSWKGITEFSDQLLEVRLANE 138 Vibrio parahae...
Q9KRJ6         60 KRQLAESFSQNYAAYAHTLKTQISADNLSISVSELVES-APNTE---MSQQLRSADKNVRTLKGIDQFTEQLLQLRLADA 135 Vibrio cholerae
Q5E125         26 KRALAQELSRAFPQLENNLKSTINQYQMSASLSDLSTQtKPQPQvrtFMAAMTTANKTEIQARGLEKYTDELLELRLADP 105 Aliivibrio fis...
Q12QN5         53 KRQIALDLSRQYQQLKPLLQQNINQYQLAVNTREMVQQaEFDAK------VLRQTDAAISQQKGLPART-ELVQLRLADT 125 Shewanella den...
tigr:AHA_3948  24 DRELARQLALQ----QKNLLPLLSNQEYQSPLPNLLQKaSPRLK-----RQARDANQAAISRQGLDGEVKELMQLRLANP 94  Aeromonas hydr...
Q2SJI2         55 KRMMASAAAREIN--PADLVRQLKENNGSVSVANVLKDvKGLSNs--FVNQAQSAERSILSKKGVRTKGETLLELRIAAP 130 Hahella chejue...
WP_014395558   42 KREVALTLAKQDPVLRKALASRLSGEQLAVDLKQWLSTvSAPSS---VTGVAERADLNIRRLKGLDRELDSLLQLRLASA 118 Corallococcus ...
Q7MFN8        142 AMLAAWQKGDvSPLFAFEPSGDDELWQYIEAFDINGQIHQLDVYNMPDVPVIVVDNNSTKELKAGLQAMQAEMKRLGQPT 221 Vibrio vulnifi...
WP_012603757  117 AMIEAWKNGE-NPLFAFEPSGDDSNWQYIEAYDVYGQVHELDVYQMPDVPVFVVDSNGAEELKAGLMAMQAEMQKLGTTT 195 Vibrio tasmani...
Q87RX7        139 KMLGAWLNGDvAPLFAFEPSGDDESWQYIEAFDVYGQIHQLDVYQLPDVPVLVVDNNSSAELKAGLQAMQAEMKKLGQPA 218 Vibrio parahae...
Q9KRJ6        136 SMLKEWQEGQ-SPLFAFEPSGNDDSWQYIEAYDVYGQIHQLDVYQLPDVPVFVVDNDSAVELKAGLQAMRAEMQRLGQSP 214 Vibrio cholerae
Q5E125        106 SMLARWQAGQ-SPLFAFEPEGAESEWQYIEAYDIDGNLHYLDVYDIPERPVLVVDTNNREELKAGLALMRDEFKAL---- 180 Aliivibrio fis...
Q12QN5        126 SMLASWQQGE-LPLFAFEPDGDDSQWAYVEAFDTQGNVHLLDVYTLPQQPVFVVGLDSKKAMMAGIAQMKAEFATAARKG 204 Shewanella den...
tigr:AHA_3948  95 EQAAALQQGV-EPLVAYVPSGDEKSWSAIEAFDSAGNPVYLDVDKAPARPVLVVEADPVKAKNAGLKVIRKALAAADMQV 173 Aeromonas hydr...
Q2SJI2        131 QMMSQLQEGV-EPLYAYEPDGDESTWQYIEAYDSNGGLHLLDVWSMPERPVVVVDINAKKDMQLGLAQMREVFSRSASKS 209 Hahella chejue...
WP_014395558  119 SMLAALQQGV-EPLYAYEPDGNDSQWRFIEAFDGLGRVHRLDVHRMPEQPVLVVDIDARRDLAAGIKLMREHLVALGQRP 197 Corallococcus ...
Q7MFN8        222 QIQpYVVEKERDAAPrma-----pqyNLSAETTAPIQTTQLKKIRLSDDQEPWISGKAEIYAIVTGVNPSRDEPALDLVE 296 Vibrio vulnifi...
WP_012603757  196 QINaDSDTNAAESKPqksslmnrarrSMALSEPEPLNTTQLTKIRLAVDQEPWISGKAEIYAIVTGVDSSRLEPQIDLVE 275 Vibrio tasmani...
Q87RX7        219 LIQpYYSESQKQSSPtl--------qSAATSDVAPIQTTQLKKIRLADDKEPWISGKAEVYAIVTGVNPSRDEPTIDLVE 290 Vibrio parahae...
Q9KRJ6        215 QLStQESSSIEASTRsl--------sRSASADTAPISTTVLKKIRLQDDKEPWISGRAEIYALVTGVDPSRDKPTIDLID 286 Vibrio cholerae
Q5E125        181 ----QSSEPSEKVKPapy------amLRAAAEPTEINTTILKKIQLKDDHEPWISGKAEIYAIVSGVSPSRDEPTIDVIE 250 Aliivibrio fis...
Q12QN5        205 NLLnKSIKGLDPVEK-----------EAVTSADAALSTTVIKQISLNDDMEPWISGKAEVYGIVTGVSPSRDTPVLDIVE 273 Shewanella den...
tigr:AHA_3948 174 A-------------------------PRAAASTAPLKTSILKKIRLKDDQEPWLLGAAEVYAVVAGVNPSRDEPVVDIVD 228 Aeromonas hydr...
Q2SJI2        210 I-------------------------QINKAQSDSINVTILDSIRLGDDEEPWISGNAEVYAIVTGVDPSRDEPALDIVD 264 Hahella chejue...
WP_014395558  198 LPV-----------------------LDTAAAATSTPVTILDRIYLNDDEEPWISGNAEVYAIVNGVDPSRDAPQLDIVD 254 Corallococcus ...
Q7MFN8        297 MPYLDYDNKDYYPNQIVIHWSRYRWGAADMVLMEQDDGTDYKQLAKLLVQVAEEVLKAIPDPEVQAYAIIPQITNKIIDA 376 Vibrio vulnifi...
WP_012603757  276 MPYLDYDKQTYYPNQTVIFWPRYRWGAADIILMEHDDGTDYKALAKLLVQAAEEILKMIPDPEVQGYAIIPQITGKIIDV 355 Vibrio tasmani...
Q87RX7        291 LPYLDYDNQDYYPNQIIIHWSRYRWGAADIVLMEQDDGTDYKQLAKLLVQVAEEVLKAIPDPQVQAYAVIPQITNKIIDA 370 Vibrio parahae...
Q9KRJ6        287 MPYLDYDKQDYFPNQVVIHWTRYRWGAADMILMEQDDGTDYKELAKQLVKVAEEVLKLIPDPEVQGYAIIAQITGKIIEA 366 Vibrio cholerae
Q5E125        251 MPYLDYAEQSYPANQIMVFWDRYRWGAADIILMEQDDKTDYKQLAQTILKAASDFLATIPDKEAQTYLIIPQMTSAIIAL 330 Aliivibrio fis...
Q12QN5        274 MPYLDYADTQYYPNQIVIHWQRYRWAAADMVLMEHDDGTNYKALATKLLEAAEQILRMIPDPEVQGLAVIAQITNGILAV 353 Shewanella den...
tigr:AHA_3948 229 MPYLDYDNTDYTPNQILVYWDRYRWGAVDIVMMEQDDNVNYKELSGLFIDALKLAFTAGGVPEALPFL---DLGGRIVKA 305 Aeromonas hydr...
Q2SJI2        265 MPYLDEDGKTYYPNQVVVYWDRYRWGAANIILMEHDDNTNYQTLAQKLLTTAAQVLSALGQPEIGALV---ALGSGIVEL 341 Hahella chejue...
WP_014395558  255 MPYLDTDGRTYFPNQVLIFWERYRWAAANVILMEHDDNTSYQELVSYLFNVASQILTAIGQPEIGALV---ALGSGLVDR 331 Corallococcus ...
Q7MFN8        377 IPDGVLTNDDDFVDVYYTLMQDTSYVDHPGAGVNAVVTLEPLTINPT 423 Vibrio vulnificus YJ016
WP_012603757  356 IPDGVLVNDDDFVDVYYTLMQNTPYVDRPGAGGNAVASFAPVTISPT 402 Vibrio tasmaniensis
Q87RX7        371 IPDGVLTNDDDFVDVFYTLMQDTSYVDHPGASVNAVVTLEPLTINPT 417 Vibrio parahaemolyticus
Q9KRJ6        367 IPDGVLVNDDDFVDVFYTLMQDTQYTDHPGANGNATATFEPLTIYPT 413 Vibrio cholerae
Q5E125        331 LPDDLFVNDDDFVDVFYTIMKDTEYTEHSGAGNNATADFAPLIIQKT 377 Aliivibrio fischeri ES114
Q12QN5        354 MPDAWFTNDDDFVDVYYTLQEGQYYHNHRGASGNATTSFAPLLINPR 400 Shewanella denitrificans OS217
tigr:AHA_3948 306 LPDSWMTNNDDYLDTFYTLEQDQSYHQYPGAAGNAVIDLEPKEIAPT 352 Aeromonas hydrophila subsp. hydrophila ATCC 7966
Q2SJI2        342 MPEHWFSNDDDYLDSFYTLEKSMHYGNHMGVSGNAMTTMRPYTLNgi 388 Hahella chejuensis KCTC 2396
WP_014395558  332 MPGEWFTNDDDYVDSFYTLEKNHTYTNYSGARGNAVVSLKPYELvgq 378 Corallococcus coralloides
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap