Conserved Protein Domain Family
DUF3102

?
pfam11300: DUF3102 
Protein of unknown function (DUF3102)
This family of proteins has no known function.
Statistics
?
PSSM-Id: 402753
View PSSM: pfam11300
Aligned: 35 rows
Threshold Bit Score: 185.882
Threshold Setting Gi: 122483753
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015261064            8 RTPLVIASEINTIKYQTGKILLTSAIEVGRRLKEAKGLLPHGEWLNWLEESVNYTERTAQTLLRIFDAYGSQQLASAdaa 87  Desulf...
Q24Y45                 61 RTPQVIAAEINSYKVSSGRIQLTCAVEIGRRLIEAKALLPHGEWGKWLEEYVEYSQATAENYMRVAREYGQAGGDSPe-- 138 Desulf...
EdlabUofT:DCF50_p550   12 RTPDIIAGEIVAIKEQTKKILLVSAVEIGRRLMEAKEKIPYGEFVAWLENAVEYSESTAYKLMRIAEAYGPDLSGTAdsg 91  Dehalo...
jgi:Sgly_1075          12 RTPDRIADEITLIKEQTKKYLLISAVEIGRRLAEVKEKIPYGEFTAWLKEAVQYSETTAYRLIRIAEEYGPGL------- 84  Syntro...
Q24RK1                  8 RTPTQIASEINLIKSRTDKIMLQSCVQIGRCLTEAKAMLPYGEWGEWLKEEVSYSQRTANHLMRIYREFGSKSASPG--- 84  Desulf...
Q24ZP8                  9 RTPVVIASEINTMKRQMEKILLVHAIEIGRRLKEVRAMIPYGEWGDWLKVSVNYSQRTAQRLMALFDAYGEYLSLPPa-- 86  Desulf...
EdlabUofT:DCF50_p1160   8 RTPHLIAAEINLIKYQTNHIVLTNTIEIGRRLTEAKKLIPYGGWGKWLKESVNYSQSTAEKMMRLYQAYGDKQPLAQ--- 84  Dehalo...
jgi:Desdi_3167         20 RTPQVIAAEINTIKHQAGKILLYSFIEIGRRLQEAKSQVNHGEWGTWLKESVNFSQNKAEKLMRIATAYGSLYPASH--- 96  Desulf...
WP_014902761            8 RTS-LIAAEINIIKHQTEKMVLNNFIEIGRRLAEAKGLIKYGEWGKWLKEEVGFSQNRAEKLMRLYEEFGREQSPLG--- 83  Desulf...
Q24TU2                 19 RTSLIIAVEINSIKDQTEKLVLHNFIEIGRRLHEAKALLPHGEWLQWLEESVDFSPNRAAKLMRLYDAYGLPHSSLL--- 95  Desulf...
WP_015261064           88 -slnAQDPNADSLntasrrvvpsaltaqaqaqPILNYTQALILLGVPEEERAQFIAELDLESMTTRELQKTVQER 161 Desulfitoba...
Q24Y45                139 ----GEKAKSETF-------------------PILSYSQALTLLDIPEEERAEFIAELDIENMSVRQLQRAIKER 190 Desulfitoba...
EdlabUofT:DCF50_p550   92 ttapGVSEKIEPF-------------------AKLGYTQAFLLLGIPAEEREEFITQFDLENMAVRELQQAVNDR 147 Dehalobacte...
jgi:Sgly_1075          85 -------SQTESF-------------------ARLGYTQALILLGLPAEERAEFITQLDIENMAVRELQQAVTDR 133 Syntrophobo...
Q24RK1                 85 ----VSLPDSNPD-------------------SNLNFSQAVILLGIPAEEREEFLACHDVENMSKRELQAAVQEK 136 Desulfitoba...
Q24ZP8                 87 ---gESSQNRAMLqggeglq-----tkegrtlPNLTFVQALTLLELPEEERAEFLMEMDVEGMSTRQLKQAVEQR 153 Desulfitoba...
EdlabUofT:DCF50_p1160  85 ----SAGEQSQEI-------------------PNLSYTQAYILLGVPEEERKAFIAEIDIVDMSTRELQKAVDER 136 Dehalobacte...
jgi:Desdi_3167         97 ----DTGTRTQAL-------------------PNLTYSKALLLLGIPEEERTDFVAELDIEGMTTQELQNAVTEK 148 Desulfitoba...
WP_014902761           84 ----DAGALGREL-------------------PNVSYTHALILLGVPEEDRAQFIRDIDIESMTTRELEQAVNEv 135 Desulfospor...
Q24TU2                 96 ----DSDAQDQVL-------------------SKLSYTQALILLGVPEEERTQLLLDLDIENMSTRELKKAVDKQ 147 Desulfitoba...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap