Conserved Protein Domain Family
DUF3096

?
pfam11295: DUF3096 
Protein of unknown function (DUF3096)
This family of proteins with unknown function appears to be restricted to Proteobacteria.
Statistics
?
PSSM-Id: 371454
View PSSM: pfam11295
Aligned: 23 rows
Threshold Bit Score: 27.1546
Threshold Setting Gi: 427981837
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Rvan_0182      8 PIIAILAGILILLRPSLLNYVVAIYLILVGVLGLVGS 44  Rhodomicrobium vannielii ATCC 17100
WP_005224588      15 AIAAVLTGVLILAVPRVLNYAVAAYLLLVGIHGLLTA 51  Marichromatium purpuratum
DSMZ:MSR1_15950   10 AIVALLCGILILIQPRLLNYVVAIYLIVIGVVGIAPY 46  Magnetospirillum gryphiswaldense MSR-1
jgi:TK90_0544     12 AILSLGAGILILIWPRLLNYIVAIYLIVIGAVGLLAY 48  Thioalkalivibrio sp. K90mix
jgi:Mrad2831_2809 10 PLIAILAGILILVMPRLLNYIVAIYLIVVGVIGLGIL 46  Methylobacterium radiotolerans JCM 2831
jgi:Ple7327_4325  25 gLLALLAGILILAIPRLLNYIMAIYLIVIAIIDLFGL 61  Pleurocapsa sp. PCC 7327
jgi:Hneap_0611     9 PLISLAAGIAILIFPKLLNYIVAIYLIVLGVLGLLGH 45  Halothiobacillus neapolitanus c2
jgi:Ajs_1741       9 PLVSLIAGILILIMPKLLNVIVALYLIVMGILGLLGM 45  Acidovorax sp. JS42
Q11EJ1            12 PLVSLIAGILILIMPRLLNYIVAFYLILVGLLGLFPQ 48  Chelativorans sp. BNC1
jgi:Tgr7_1149      9 PLLALIAGILILIRPKLLSLIVAIYLIAIGIIGLLNI 45  Thioalkalivibrio sulfidiphilus HL-EbGr7
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap