Conserved Protein Domain Family
DUF3095

?
pfam11294: DUF3095 
Protein of unknown function (DUF3095)
Some members in this bacterial family of proteins are annotated as adenylyl cyclase however this cannot be confirmed. Currently no function is known.
Statistics
?
PSSM-Id: 402748
View PSSM: pfam11294
Aligned: 27 rows
Threshold Bit Score: 372.735
Threshold Setting Gi: 504014189
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8F9P3                     16 FYKYLP----SLSSF-TDIIEPSNYFTVPDDWNLIITDVVNSTDAIRSGHYKDVNIAGCITAMAVSNLMGDMD----YPF 86  Le...
jgi:Arnit_1582              6 FYREIK----EIKDF-SFIMNNDNYHKVPDDWFVLVSDIVDSTKSIEEGMYKKVNFVAALTIIGILNIDKSLE----FPY 76  Ar...
WP_015182487                6 FYSELP----TLEHF-VEITNSQNFLPVHPDWYIVITDIMGSTQAIEAGRYKDVNILGVSSIIAILNRAKHLE----IPF 76  Mi...
jgi:Syn7502_00707           9 FYSDLP----YIHEF-IDITELANFASMPSSWFIIITDIVNSTILIETGHYKNVNLVGACTIVAMLNIADPID----IPF 79  Sy...
jgi:Cpin_6058               8 FYSRLPvnriPLSEL---LTEDHLFYKIPEDWFVIVTDIKGSTAVVQSGQHETVNLVATGSIVAVLNISFKANi--tVPF 82  Ch...
WP_014780873                9 FYKNIPksklPLTEL---LKNETLFYNVPKSWSIVVTDIENSTEAVNRGAHNDVNLSATGSIVTVLNTLKALNqknkIPY 85  Ae...
EAQ42310                    7 FYKTIKknriALKDL---LQNENLFSSVPKNWHIVVTDVQNSTLAVANGKHNDVNLTATGSIITVLNKIKKLDaevrIPY 83  Po...
jgi:Spiaf_1263             21 eYTQLT----PLQSF-EAILDASVYQAVPDMWVVIVTDVADSTRAVSNGLYKEVNIAGAAAISAVSNLIGSLD----FPF 91  Sp...
BOB002_L21SP2:L21SP2_2151  12 yYLHLP----LINDFsAGLEEG--IRPVPQDWYIAITDIVDSTKAIEAGKYKQVNVSGALPIIALARMYDSLK----RPF 81  Sa...
WP_012387968                4 FYKNLK----PSSQF-QSIFEDTIVSKVPDDWFVLITDIVGSTKAIEEGRYKDVNTAGGLTAIAVANVYGHMD----FPF 74  Le...
Q8F9P3                     87 LFGGDGMTLLLPDSALPGVRDILFSIRELVKSNFGLKLRAGIVNVGELKKTGKELKLCKLKISDFYNQAILTGNALDVAE 166 Le...
jgi:Arnit_1582             77 IFGGDGASLIIPPTLVDKAKVVLLQTAQKAKEAFDLDLRVGIISIKEIKKRGSFIEVTKFKVTKDFTQAIVRGNGLELAE 156 Ar...
WP_015182487               77 VFGGDGASLLIPPSLFLDTKQALLATQDMAKREFNLGLRVGIVPVATVRDANYDVRVAKVRVSAKYTQAVFTGGGLTYAT 156 Mi...
jgi:Syn7502_00707          80 VFGGDGASILIPANLLVSAQNALINIQNLVKDSFAIDLRVGIIPVAKVMRE-HEIRVAKLQVSPNYSQAIFKGGGLTYAT 158 Sy...
jgi:Cpin_6058              83 FFGGDGATFIIPPSVKDAAIKALLLYKKNTQESFDINLRIGVVAVNDIYAAGHTLRVSKFNSSGNFHIPVVLGNGLNYAE 162 Ch...
WP_014780873               86 FFGGDGSTFIIPNAVLEPVLEALNNFSEHIKKTVELNLRVGHLGVEQVYANNVSLRISKVRHNKYFTTPVVLGNGLKYAE 165 Ae...
EAQ42310                   84 FFGGDGATFIVPPSIILEVLKVLTDYCIHIKNTLDLDLRVGSLEVEEVYKNDFTLRISKLKVNDFLTTPVILGNGLKFAE 163 Po...
jgi:Spiaf_1263             92 SFGGDGATILLPPALATHALPALGELRARVAAAFGLELRVGSISVGELRGYGADLGVARVALGNRVTQASFEGSGLAVAE 171 Sp...
BOB002_L21SP2:L21SP2_2151  82 VFGGDGMTFLIDGNHYEEARSILSRTIRDVQVFFGLHLRAALIPMSEIYRRGGSLALSKHQVSEHYTQAFFHGSGIRMAE 161 Sa...
WP_012387968               75 VFGGDGVTFLLPINLLFPIRSAIADTISQVKAAFGLEMRAGIVPVQELYRAGTELFLSKFKASEHYVQCSLFGTALPLAE 154 Le...
Q8F9P3                    167 SFIKNdd-ssNPYIIPLTHKIKIk--PDFTGFTCRWQDI--PSHRGETVSFIVKMNSpsTSSDQELLKIVLDQVSVLLGN 241 Le...
jgi:Arnit_1582            157 YLLKN-----EYKTFKIEENFTFnytADFVGLECRWEDI--KSPKDETSSLLIKSTN--PEKSNEIYQNTLNKIDEIAGS 227 Ar...
WP_015182487              157 ELVKNpe-tsELYSLSSSGIIPQ---ADFSGLVCPWQDI--PSQHGEILSLIVMATAhqGQEETSIYKEAIKKIYKIYGG 230 Mi...
jgi:Syn7502_00707         159 RLVKDs----DTYQLKHHSSDGV---TNFAGLECRWQDI--NGRHGEILSLIVQATTanQSQSDQVYKRVITKISKIYGA 229 Sy...
jgi:Cpin_6058             163 RLIKG-----EDYLLPGDLLADDe--VDLSGMQCRWDKIkpPESNYEVVSLIVMATK--PEEQASAFRQVITHIDAIYGA 233 Ch...
WP_014780873              166 HLIKEn---fKVSDINSTENTT----PNLEGMECRWDEIypNETDKKVICLLVDCDD--ESKQAEVYGAIMNEIELIFGN 236 Ae...
EAQ42310                  164 SKIKQq---fEGNNLPDQEKLL----IDLKGMECRWDEIypSANSKRIACLLISATS--ETKQAEIFNQIINEIDYIFGD 234 Po...
jgi:Spiaf_1263            172 QLLKTgr--lEPLDVPPGS-------ADISGFSCRWRDV--PSAAGETLAIIIMPLGdaPAGRMGTLRKTWRLIESVAGA 240 Sp...
BOB002_L21SP2:L21SP2_2151 162 DMLKSpgeddAAFIIEAADDTRS---VNYKGFTCRWADI--PGSSDVTAALIVEGRN------GMPAAEVIRLIESVLGD 230 Sa...
WP_012387968              155 QWIKEgk--dESYLVRENEKILP---ADFTGFTCRWKDV--PSERGEIVSLIVKPNHsdLEVCKKIVTRVLNFIRSEYGE 227 Le...
Q8F9P3                    242 DVEIHPL-KEEKIKVDLSGKYPSKEATVHSGsrTGIFYFLRRIKIKIEGLAVNLAIKtqwrfgpkINGKELRELRKSQVI 320 Le...
jgi:Arnit_1582            228 YVQRNPIkEINQLVISFNPMVLNAEASVFAS--NIFSRFFLILQLLIENLLGVLLMK--------YSKGQWSDYKNRVIR 297 Ar...
WP_015182487              231 ANNFHPV-DFERIRLSLNRQILYKETQVVHQsqNWWYKQLSLWQKL----LGIIAIKvs----ikLGLIDWQTNKKTLIS 301 Mi...
jgi:Syn7502_00707         230 EHKLNPV-SPERLNLSFSPKQLSSETKAKSKktSWLGRQSYLLKITLENLLAWIVIKlk----lkTTDIDWGDYKNIVTD 304 Sy...
jgi:Cpin_6058             234 PEKRQPI-SIPQLRLKTTFAELGLELRARFGrkRLFKLIQSWFTTF----LGYIYFR----------TRQGKSYLTRLVE 298 Ch...
WP_014780873              237 LEKRNPI-STLKLKLNTSLAKIRKEMLMKLGkhQITYLISNWVVTH----IGKYYFQ---------FFKSGKLYKHRITQ 302 Ae...
EAQ42310                  235 LHQRNPI-TIQRLKLKPTLKKIKKEMYTRIGvyKSGYLMNNWLITF----FGQYYFK---------FFNSGKSYLYKVTQ 300 Po...
jgi:Spiaf_1263            241 -NELHPV-RNGTQRMIHRQREINREARLYAGrrRGMRVFLQRLSIRFQ--LFVVGIAlglhlplqQHGKDLSRVTADNII 316 Sp...
BOB002_L21SP2:L21SP2_2151 231 SSSYHPL-KMENMNMGGSRSDWSLTPLVMSRgrKSPAYFFRAAVAWVEIQLAKIAMAlkl--plkQDIYQMNRLREQNIA 307 Sa...
WP_012387968              228 EKDYHPL-SLNQIELD-NGDHLRKEAVARTGkhSGLKFRLTLMQIWIERTLMAAAIRwkl--pikSGHYSLDRLKEYQVM 303 Le...
Q8F9P3                    321 ASDFRKYDGTLKMVIACDSDSRESFLKFLDDLYRQGKLFYGYHVSDRALMTCALHEGSIREVHFVDSADGGYALAAAQLK 400 Le...
jgi:Arnit_1582            298 TTDTEKFDDMLRMVISTDKMQTKKLEEYLEQEFQNGNLVYGIHKSDSALMTCLIFERHGKHIHFVDSSNGGYALAAKELK 377 Ar...
WP_015182487              302 DSDYQKFDDILRMVISGNSGQREKLIRYLETQYKAGKLVYGFHVSDRALMTCLVYKAQGRHTAFIDGADGGYALAAKMLK 381 Mi...
jgi:Syn7502_00707         305 ATDYRKFDDLLRMVISSTTAQRKQLLNYLETEYVNGRLVYGFHVSDRALMTCLVFERNGRQVHFIDGADGGYAYAAKVMK 384 Sy...
jgi:Cpin_6058             299 MSDTLVIDGKINTVITGTETQRLQLVKHLNQLEEAGRIFYAFYVSKESVMSCYVRDFKQEHIHFVDGAEGGYTKAAGVLK 378 Ch...
WP_014780873              303 LSDTIMLDGFLNTVITGTDEQVDKLKILLDDLELRKEIIYGMHITHASIMSCYIEDREEKHVHFVDGTEGGYTSAAIMFK 382 Ae...
EAQ42310                  301 LSDTIMLDGSINTVISGDDRQFAKLKTFLDSLELSGKIIYGLHKTYASILSCYVEDRDRKHIHFVDGTEGGYTTASIEYK 380 Po...
jgi:Spiaf_1263            317 HADFRKYDGQLKLVVSCSTAQREQLLQQLGEMEDQGQLVYGHHISDRAVMTCLIHTRSEQEIHFIDGADGGYTQAAAEIK 396 Sp...
BOB002_L21SP2:L21SP2_2151 308 NSDFRKYEGALKMIFSADESAVDALEQALDKEVQAGRIFYGVHRSKEAHMTCIATLESGDDVHFIDATGGGYALAAAALK 387 Sa...
WP_012387968              304 SADFRKYDGTLKMVIDGSKKHRLALERFLEQLEREGLLHYGMFVSNRSLMTCVLKVASSAEVHFVDGADGGFAMAAKVLK 383 Le...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap