Conserved Protein Domain Family
DUF3091

?
pfam11291: DUF3091 
Protein of unknown function (DUF3091)
This eukaryotic family of proteins has no known function.
Statistics
?
PSSM-Id: 151732
View PSSM: pfam11291
Aligned: 11 rows
Threshold Bit Score: 109.747
Threshold Setting Gi: 122061947
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5DAQ4  68 IDRLSENLENTYKNNSRRAIEILRNEKSKLQLIFNTwqSEKSNMTCNRPENISEDDFNKLLQLIQRRQYTNMALTYYKLE 147 Schistosoma japonicum
Q5C4B0  94 IRHLTEEINREYSNFSKTALEKLKQLEQGLKLLVDN--SEIEKMTCTVPKVVDEKYLDYLVRSIIKKSNKPFVMTFFNWK 171 Schistosoma japonicum
Q5BX84 194 IDKLKKEIETNYPNNSRRAIEMLNYKKVIEQLIFNTsqSEKSNMTCNRPENISLHDFNNLQELLKRKEETIMILDYFKLR 273 Schistosoma japonicum
Q5BZX1 109 IDNLKKEIERDYPNNSRRAIKMLSKRKGRQQLIFNTsqSEKSNMTCNSPENISEDDFNKLQDLLRKKQRTDLASTYIKLK 188 Schistosoma japonicum
Q86E41  43 IDYLLNEIQRDYPKYFREEFHTIVRSYNILEEYYEVveSKVQNTTCSVPENINEEDLIKLKYLMWDEAINGFYKKYYHLE 122 Schistosoma japonicum
Q5BY68  85 IDYLLNEIQRDYPKHSAEVLKEIRRCRGKLSQHFDNlwAQQNTLICNRPGNIDKDDVEDLENEISIHKSTIFYLKFSKLE 164 Schistosoma japonicum
Q5DBF1  63 MKSFEEEIRKDFAEFPEEVFEKIMKFSEELKQLYGKsqSNAKNISCAKPENINPEDVTNLENSIKNYQSALVDFNIFNLK 142 Schistosoma japonicum
Q5DGG2   1 MESFKERLRSDYRKFPEEVFEKIMKHSEKLKQQSDLsqSKVENMTCNKPKNIPANDDINLENSITNYQSASVYLNIFSTQ 80  Schistosoma japonicum
Q5DC11  16 MKSFEEEIRKDYAVFPEKVFEEIMYYTKDLERESGWkqSKVENMTCIRPKNIDANDVVGLENAIAKFEFEKFNHGTLLLK 95  Schistosoma japonicum
Q5BZA3   4 IGYLSDELKKNYPNYSANVLEEVNRCGVTLKQFFNEleSKENRGTCNLPKNIHWKDLLNLQSIIWAQQTDLVDINVYELK 83  Schistosoma japonicum
Q5BTA5 162 LGKFRDEMAKDFPNYSANVLEEVNRCGVTLEQFFTEleSKENHTSCTKPENIKEKDLRNLQSIIFDQKTDLVDINVYELR 241 Schistosoma japonicum
Q5DAQ4 148 KKALLLVWEDLTNAVDKRSE 167 Schistosoma japonicum
Q5C4B0 172 IDVLSLVLEEMKQPVMKQST 191 Schistosoma japonicum
Q5BX84 274 RYALITVSVYLNNPVDESSE 293 Schistosoma japonicum
Q5BZX1 189 KKALLLVWEDLTNAVDKRSE 208 Schistosoma japonicum
Q86E41 123 NDYYLKLKENLENSANNPSE 142 Schistosoma japonicum
Q5BY68 165 KDYYLKLKENLENSANNPSE 184 Schistosoma japonicum
Q5DBF1 143 KQYYSNLKKKLENLAKNRSE 162 Schistosoma japonicum
Q5DGG2  81 NNYLIDLKKKLENLVKNPSE 100 Schistosoma japonicum
Q5DC11  96 RRYLFEVNKSYQNSVKKPSV 115 Schistosoma japonicum
Q5BZA3  84 KHYFSQLMRNLKNLANKRSV 103 Schistosoma japonicum
Q5BTA5 242 KRFLNKIKKNIQNSARKYSE 261 Schistosoma japonicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap