Conserved Protein Domain Family
DUF3086

?
pfam11285: DUF3086 
Protein of unknown function (DUF3086)
This family of proteins with unknown function appears to be restricted to Cyanobacteria.
Statistics
?
PSSM-Id: 402740
View PSSM: pfam11285
Aligned: 36 rows
Threshold Bit Score: 404.708
Threshold Setting Gi: 500468057
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012164549       55 NDHLKTLEERKQTLQIAVDQLERRQERVQAEMRQSFAGVSQDLAIRIHGFHDYLVTSLQDLVIAAEKLELAPKetakpqa 134 Acaryochlo...
jgi:Cha6605_5324  166 QTSVTELEQRRQKLQISVEQLERRRDRLKEEISKSFAGASQDVAIRLQGFKDYLVGSLQDLVVIAEEIEFPQPppaqi-- 243 Chamaesiph...
jgi:Pse7367_1846  384 TEQVLELEQKRNELQASVSVLQRKQERLQKEMRTTYAGASQDIAVRVQGFKDYLVGSLQDLVASAEQLNLAPPa------ 457 Pseudanaba...
jgi:Syn7502_00004  63 QDSLTEYQTRKQEITAEIAVLQRKYERLQNEMKTIYAGASQDVAVRVQGFKDYLLGSLQDLVGTVEKLNLVPKpv----- 137 Synechococ...
Q31RA7             69 AIALADLEARQAALLASIEKLERRRDRIQQEIRSSFAGKSQEIAVRVQSFKDYLVGSLQDLAASAEQLDLVPPqpiaa-- 146 Synechococ...
WP_015110519       33 ELALTELRERRAALLGEISELESRREQIRQEIAGSFAGQSDAIARRLKGFQDYLVGALQDLAAAAEQMELVVQplv---- 108 Cyanobium ...
WP_011934891       13 QLALQELQQQRQSLEGEIKELEQRRDQLQAEISSHFTGQADGLSRRVKGFQDYLQGALVDLARSVEQLELVPEtla---- 88  Synechococ...
Q7V5Y4             68 QVALTELQQRRDHLEAEIKDLSNRKSQLEKELSSSFAGQSDAIARRVKGFQDYLTGALQDLAQSVEQLELVVQpvv---- 143 Prochloroc...
Q7VAQ0             62 QLALKDLEEKRTELESDIKDLEKRKIKLEKEVSQSFSGQSDSIARRVKGFQDYLTGALQDLSQSVEQLELIAQpvv---- 137 Prochloroc...
WP_011933830       42 QLALTELQERRDALQQEIETLTQRKQQLETEMAASFAGQSDAIARRVKGFQEYLSGALQGLAQSVETLELVAQpvv---- 117 Synechococ...
WP_012164549      135 papqvaptprPEPAaerrpaeqrpprsgPSRQSRPPQQRSTPPQrgpkFATQEFEEETRQIRQILDQYRTNPNYYGPPWQ 214 Acaryochlo...
jgi:Cha6605_5324  244 ------rlqtPLPKt-------------PAPQPQPASKDRSSPQ----FTEPAFKATAGKVRAAIDRYRSAPDYYAPAWQ 300 Chamaesiph...
jgi:Pse7367_1846  458 ----------PEPT--------------VTVEQTPIEEPPKPPD----LAEQSFGEYRQQVEKILTQYRTLPDYYGPPWK 509 Pseudanaba...
jgi:Syn7502_00004 138 --------kvAEPE-------------------LKKVAAVEPPS----LTEQAFGDQKQKIEQLLERYRTLPDYYGPTWK 186 Synechococ...
Q31RA7            147 -----peiiaPPPA-------------------SVEAKAPLRPG----FADPEFAPEAELIEQELNRYRQSPDYYGQPWV 198 Synechococ...
WP_015110519      109 --------vqPSPLd-------------QA--TTGTEASGAPQVtaapAAAGLFSDDADLIRERLEQFGGQPDFYADPWK 165 Cyanobium ...
WP_011934891       89 --------vqPSPLd-------------QQQQQEAAKASEEEPApapvSASGLFAGETTLITERLAAFRDNPDFHADAWQ 147 Synechococ...
Q7V5Y4            144 --------vqPSPLd-------------QP-----NSTPEAAAQgnalAVADTFKPDESLIRECLEQFLSQPDFYADPWK 197 Prochloroc...
Q7VAQ0            138 --------vtPSPLd-------------KTNIETSTVSEKAEEIa---AIADTFKPDKDLILQLLGQYIEGPDYYANPWK 193 Prochloroc...
WP_011933830      118 --------vhPSPLd-------------AQ----AAAADQAASAgatpALADTFRPDEELIRANLKRFLEQPDFYADPWK 172 Synechococ...
WP_012164549      215 LRRTFEPIHAERVASWFFTFGGRGALRTLSSRLQNILVASATISILRQLYGNSVRTLILANSPERLGDWRRGLQDCLGID 294 Acaryochlo...
jgi:Cha6605_5324  301 LRRTLEAVHADKVSDWFFTKDGRGAVRTMGSRLQNILVAAAAVSVLRELYGDYLRTLVLANLPERLGDWRRGFQDCLGLS 380 Chamaesiph...
jgi:Pse7367_1846  510 LRRTFDATHAERVSNWLFEQAGRGAVRTMGTRLQNILVAAAAVSIMRSIYGDRVRILVLATSPERLGEWRRGFQDCLGIS 589 Pseudanaba...
jgi:Syn7502_00004 187 LRRTFEATHAERVSNWFFAQAGRGAIRTMGTRLQNILVAAAAVSILRSLYGDKIRVLILATSPERLGEWRRGFQDCLGLN 266 Synechococ...
Q31RA7            199 LRRTFEAVHEEPVREWFFTMGGRGALRSFGSRQQNVLIASAVISVLNHLYGERLVPLILASTPERLGEWRRGLQDCLGLS 278 Synechococ...
WP_015110519      166 LRRTLEGSAATRLEDWFLSQGGRGAQPSGGSRSRNALAAAAAIAILGELYGERFQTLVLASQPERLGEWRRGLQDCLGLS 245 Cyanobium ...
WP_011934891      148 LRRSLDQSGHDLLSDWFLSQGGRGAQPSGGSRSRNVLVTAAAVSLLGDLYGERFQTLVLAGAPERLGDWRRGLQDGLGLS 227 Synechococ...
Q7V5Y4            198 LRRSLDPRDKELLEDWFFNQGGRGAQPSRNSRTRNILVAAALIAILGELYGDRFQSLVLAGEPERLGEWRRGLQDALGLA 277 Prochloroc...
Q7VAQ0            194 FRRSLDAQDAEILEDWFFNMGGRGAQPSLGNRSKNVQLSAALIAILGELYGDRFQALVLASQPERLGEWRRGLQDALGLN 273 Prochloroc...
WP_011933830      173 LRRSMDAADTSVLEDWFFNQGGRGAQPSRGNRPRNVLLAAALIAVIGELYGDQFQTLVLAGQPERLGDWRRGLQDALGLG 252 Synechococ...
WP_012164549      295 RSDFGPERGLILFESPDALAQKADRLVKEQQLPLILIDDAEEEVSLSILQFPLWLAFAPEPQLRK 359 Acaryochloris marina
jgi:Cha6605_5324  381 KPDFGGNGGIILFEDPEALIQKVDRIVANKEMPFIIVDNSEGQISLSILQYPLWLAFAPDPDRQL 445 Chamaesiphon minutus PCC ...
jgi:Pse7367_1846  590 RDSFGPDRGVVLFEDPDPLTFKGDRLVKDGLKPMVIVDEAEEFLFIDMLRFPMLLAFGRDPEAKT 654 Pseudanabaena sp. PCC 7367
jgi:Syn7502_00004 267 RENFGPEKGVVLFEDPDPLCLKGDRLTTEGQMPLIIIDEAEESISIDTLRFPLLLAFGRDPAAkn 331 Synechococcus sp. PCC 7502
Q31RA7            279 REDFGPNQGITLFEFADALVQKAERIEERGDLPLIVIDDGEDSVSLSLLQFPLWLAFAPDPRQPS 343 Synechococcus elongatus P...
WP_015110519      246 RDDFGPASGIVLFERPDALIERADRLEERGELPFIVIDAAEQVIEIPILQFPLWLAFAAGPGELD 310 Cyanobium gracile
WP_011934891      228 REDFGPNSGVVLFERPDALIERADRLEEQGELPFIVVDAAERAVETAILQFPLWLVFAADPQELA 292 Synechococcus sp. RCC307
Q7V5Y4            278 REDFGPSSGIVLFERGEALVERADRLEERGEVPLILIDAAQRSVEIPVLQFPLWLAFAAGPQERF 342 Prochlorococcus marinus s...
Q7VAQ0            274 REDFGPNSGVVLFERAEPLIERADRLEAENEVPLILIDAAERNIEIPILQFPIWLAFAATNEELY 338 Prochlorococcus marinus
WP_011933830      253 REDFGPNSGIVLFERGDALVERADRLEERGEVPLILIDASEQVVDIPVLQFPLWLAFAAGPGETD 317 Synechococcus sp. WH 7803
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap