Conserved Protein Domain Family
Attachment_P66

?
pfam11263: Attachment_P66 
Borrelia burgdorferi attachment protein P66
P66 is an outer membrane protein in Borrelia burgdorferi, the agent of Lyme disease. P66 has a role in the attachment of Borrelia burgdorferi to human cell-surface receptors.
Statistics
?
PSSM-Id: 402723
View PSSM: pfam11263
Aligned: 2 rows
Threshold Bit Score: 412.18
Threshold Setting Gi: 576314713
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ETZ18764     336 SDFSILGHISRKAN------TDEKKQ---FDPVSNKLQFDTKRTPNFEFSVGTGIGLAWNTDEGEEESWEIKGSKSYNKR 406 Borrelia dutton...
WP_031541142 104 SDFSVFGHISKAANfkketpSDPNKKaeiFDPNGNALNFSKNTELGIAFSTGASIGFAWNKDTGEKESWAIKGSDSYSTR 183 Lyme disease sp...
ETZ18764     407 IFGAQDKKSGIGFGINYGKSLYRPTSSNTLIQNIAKKSFQTLNAELSTYEDNKKGIIPGLGWIASIGIYDLLRDKPKSD- 485 Borrelia dutton...
WP_031541142 184 LFGEQDKKSGVALGISYGQNLYRSKDTEKRLKTISENAFQSLNVEISSYEDNKKGIINGLGWITSIGLYDILRQKSVENy 263 Lyme disease sp...
ETZ18764     486 -DIIAALTPN-------T-TLTNKTNIEFASATQLGGALYLDYAIPLKSMSPNTYIIPYVGAHMLG---TLNFPKNTLYL 553 Borrelia dutton...
WP_031541142 264 pTTISSTTENnqteqssTsTKTTTPNLTFEDAMKLGLALYLDYAIPIASISTEAYVVPYIGAYILGpsnKLSSDATKIYL 343 Lyme disease sp...
ETZ18764     554 KAGLELENLIKLT 566 Borrelia duttonii CR2A
WP_031541142 344 KTGLSLEKLIRFT 356 Lyme disease spirochete
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap