Conserved Protein Domain Family
IRF-2BP1_2

?
pfam11261: IRF-2BP1_2 
Interferon regulatory factor 2-binding protein zinc finger
IRF-2BP1 and IRF-2BP2 are nuclear transcriptional repressor proteins and can inhibit both enhancer-activated and basal transcription. They both contain N-terminal zinc finger represented in this family and C-terminal RING finger domains.
Statistics
?
PSSM-Id: 402721
View PSSM: pfam11261
Aligned: 6 rows
Threshold Bit Score: 106.03
Threshold Setting Gi: 47209844
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_784488     13 HRQHCYLCDLPRAPWALLHDFSEPVCRGCVNYEGADRIESVLEGARQMKRAH 64  purple sea urchin
Q17I53         6 KRQHCYLCDLPRMPWAMIHDFTEAVCRGCVNYEGADRIELVLDTARQMKRIH 57  yellow fever mosquito
CAP26997      84 PRQQCYLCDLPRWPWAIINEYIEPVCRGCVNYEGSDRIELVLEEARQQKKLQ 135 Caenorhabditis briggsae
XP_003385563  20 gRTKCFLCEVPRGPWAMIYDFHEPVCRACCNYEGIDRIAEVVDKARHLRRSl 71  Amphimedon queenslandica
CAF95010       3 RRQWCYLCDLPKTPWALLWDFSEAVCRGCVNYDGADRVELLIDAARQLKFSH 54  spotted green pufferfish
BAE32550      10 RRQSCYLCDLPRMPWAMIWDFSEPVCRGCVNYEGADRIEFVIETARQLKRAH 61  house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap