Conserved Protein Domain Family
DUF3053

?
pfam11254: DUF3053 
Protein of unknown function (DUF3053)
Some members in this family of proteins are annotated as the membrane protein YiaF. No function is currently known.
Statistics
?
PSSM-Id: 402716
View PSSM: pfam11254
Aligned: 14 rows
Threshold Bit Score: 197.58
Threshold Setting Gi: 163260759
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Rahaq2_1074  18 FMMLLMI--FVLSGCGDKEPAQRKAFMDFLQSRILDKpVLAVPQLTEAQKKEFGDYTKDYAI-ITGFHHQMNIELDSSLV 94  Rahnella aqu...
WP_013320035     14 VVMLVAA--LQLSACGDKDKDARQAFITFLQGISQQE-GRQLPALSEQQKQSFGRFTQDYAV-MTAFNQQLDQALAGSLT 89  Dickeya dada...
Q6DB16           11 VLVILAA--LQLAACGDSEAEQRKAFIAFLQSVQSQQ-DGILPALTEEQKKNFGNFTNDYAI-LTTFSQQFNQAVSGSLT 86  Pectobacteri...
P0ADK0           14 LAALLMV--VSLSGCFDKEGDQRKAFIDFLQNTVMRS-GERLPTLTADQKKQFGPFVSDYAI-LYGYSQQVNQAMDSGLR 89  Escherichia ...
Q7CFP6           19 LLAFLVM--FLVTACGDKELEQRKAFIDYLQNTVMRS-GMKLPTLSEDQKQKFGPYVSDYAI-LVTFSQQLSKSVDASLV 94  Yersinia pestis
jgi:Rahaq2_0027  17 FIALLVV--FQLTACGDKEPEQRKAFIDYLQNTVMRS-GQNLPSLSEDQKQRFGNYANDYGI-ILSFSRQMKGAVEGSLV 92  Rahnella aqu...
utah:Sant_0098   17 LVLLLGV--FQLTGCGDKEPEQRQAFIQFLQNTVLPG-GERIPTLSAAQKEQFGPYANDYQI-LQTFSDKFLSSVNGSLV 92  Sodalis prae...
Q8ZQ15           12 VIVPLVI--AMLTGCEGKGDSSRRAFVEYLNTQIITSpVVGVCELTPAQRQAFGHYADDYDVlLTAYGQIFAVVYETGQE 89  Salmonella e...
Q881W3            8 GLLLAVAlpLLLAGCGDKEPEQRTAFSQFLQTRIIDKpGVHVPKLTDEEKKAFGDYTSHYAV-ISDF----GSGMDTAVQ 82  Pseudomonas ...
CAP43061          8 iwLLAAG--LLLAGCVNKEPDQRAAFMAWLQASVVEApGAAVPALDDAQRDAFGDYVEHYQV-LADF----DAVAATVVE 80  Bordetella p...
jgi:Rahaq2_1074  95 PVFAGMN--GVNSVSNLLEQRDDLKKMADSSERWKERIVLLKTQADTQHAALKQPDDLKKIYDQAYEKTIVKPSQITEQV 172 Rahnella aqu...
WP_013320035     90 PMLDVVS--RIRVPQDYVTQRDNLRQALGGLNMLSPQVQNAKTQADNAHRALKQPEELQTVYDKVYNRAVSLPANAMVTV 167 Dickeya dada...
Q6DB16           87 PMLGQIS--RIRVPKDYLTQRDALRQSVGTMSLLAQHVQAAKAQADNTHRALKQPEEVQIPYERLYARTVIQPTNALLPA 164 Pectobacteri...
P0ADK0           90 PVVDSVN--AIRVPQDYVTQSGPLREMNGSLGVLAQQLQNAKLQADAAHSALKQSDDLKPVFDQAFTKVVTTPADALQPL 167 Escherichia ...
Q7CFP6           95 PAIEQIN--QIRVAQDYLSKRDALQQSAGALNLLVQQIRTAKAQADSAQAALKLPDDLKVVFNRAFDNIVTQPANVLIPA 172 Yersinia pestis
jgi:Rahaq2_0027  93 PVVSAIG--QVRTPQDYMTQRSALQQAASTLSLLNAQLRDSKVKADTAMAALKQPDDLKAVYSQVYNSVVTQPANVLTPL 170 Rahnella aqu...
utah:Sant_0098   93 PVLDEIS--QIRVPQDYVSHRQTLAQAGGALNMLAPDLARAKKQADDGRAALKQPEDLQKVYNQAYDKLVTGPIQKVTPV 170 Sodalis prae...
Q8ZQ15           90 DKITGV----IQSERDNLVFLNELRVARDVNNRFILRLKNVSSENRKKYSALKLPADVKPVFDAAWNKTVTPLDETMTRY 165 Salmonella e...
Q881W3           83 PLAGLMQkgSFRSVSDVIERRADLASVQKGLDEVGEKLTIEQGKADAAHAKLKQPDDLKVVYDKAYDRTVSVPANTFREV 162 Pseudomonas ...
CAP43061         81 RLGRALEhqELHTLAQLRARQDALLADRQALSEARASLRRALERAGTERAGLEQPADLQAVYAQAYGRAVTGSAARLEPL 160 Bordetella p...
jgi:Rahaq2_1074 173 FDLLPQVLNLIVAKADFIKNQ--GKNVTITGNRLQF------ANQKQLDKYNAIQQK-----LVPLNAQLMQLSR 234 Rahnella aquatili...
WP_013320035    168 VPASTSFAQSVVQVGDYLQTQ--GNQVVFGNNGVQF------HTQQQVDQYNSMMTD-----IANQQQKLFTTLK 229 Dickeya dadantii
Q6DB16          165 IPNATSFAQSLIQVGDFLQAQ--GDQAEFNGASVQF------RTPQQVAQYNGMVAA-----LPVQQQNLMNALR 226 Pectobacterium at...
P0ADK0          168 IPAAQTFTQQLVMVGDYIAQQ--GTQVSFVANGIQF------PTSQQASEYNKLIAP-----LPAQHQAFNQAWT 229 Escherichia coli ...
Q7CFP6          173 VPVVSSFVQDLVQVGDFLQQQ--GTQVTFNNGGIQF------QTPQQAAQYNTMMSN-----LVAKYPEMMAAQK 234 Yersinia pestis
jgi:Rahaq2_0027 171 VPALQSFTQDIVSVGDFLQQQ--GTQVAFANGGVQF------PTQQQATQYNTMMSN-----LVGKQQTLLQAQK 232 Rahnella aquatili...
utah:Sant_0098  171 IGAAASLAEQLVHVGDFLAMQtgQGQPSYEGGSVSF------PTQLQVTQYNELMTG-----LQNQHQQLLQAQN 234 Sodalis praecaptivus
Q8ZQ15          166 YFLRGKRLDQLVAMGEFLQKQ--GNKVRFETNGKAVfadlaaKEHFQDQQFNFFITQndinhLTQQMVEFINSQQ 238 Salmonella enteri...
Q881W3          163 LPQVKGTFASSLKVADYVEAH--KSQIDISGSAITV------KDPVVQTELNKLLLE-----LNEQGKNAQQAQA 224 Pseudomonas syrin...
CAP43061        161 LAVAAAALDDAVRAAEYVVRH--RGQIVIDAESASV------RDPSVQQELNRLLDA-----LNGHAEAVGQAQR 222 Bordetella petrii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap