Conserved Protein Domain Family
DUF3051

?
pfam11252: DUF3051 
Protein of unknown function (DUF3051)
This viral family of proteins has no known function.
Statistics
?
PSSM-Id: 151694
View PSSM: pfam11252
Aligned: 5 rows
Threshold Bit Score: 348.93
Threshold Setting Gi: 75552270
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q70AF4   1 WLEHIRLIVVTMVPILLLPDTTIGRHIHIKRQYLQSVLLWLARNKLYYRVKRCRSKRFVLEQDHIGPELFRTQLLQYAGL 80  Sugarcane yellow leaf...
Q704K6   1 WLEHIRLIVATMVPILLLPDTTIGRHIHIKRQYLKSVLLWLARNKLYYRVKRCRSNRFVLEQDHIGPELFRTQLLQYAGL 80  Sugarcane yellow leaf...
Q704I2   1 WLEHIRLIVATMVPILLLPDTTIGRHIHIKRQYLKSVLLWLARNKLYYRVKRCRSNRFVLEQDHIGPELFRTQLLQYAGL 80  Sugarcane yellow leaf...
Q2L3I0  68 WLEHIRLIVVTMVPILLLPDTTIGRHIHIKRQYLQSVLLWLARNKLYYRVKRCRSKRFVLEQDHIGPELFRTQLLQYAGL 147 Sugarcane yellow leaf...
Q9JH80  68 WLEHIRLIVVTMVPILLLPDTTIGRHIHIKRQYLQSVLLWLARNKLYYRVKRCXSKRFVLEQDHIGPELFRTQLLQYAGL 147 Sugarcane yellow leaf...
Q70AF4  81 DVFQDVARLQDFLERGYDTFRSVLGVHLLEHERFVSRILEQPVMEPDQAVRLCFHYHNTLDHDDDDSGLETDFNNLSLGR 160 Sugarcane yellow leaf...
Q704K6  81 DVFQDVARLQDFLERGYDSFRSVLGVHLLEHERFVSRILEQPIMEPDQAVRLCFHYHNTLDHDDDDSGLETDFNNLSLGR 160 Sugarcane yellow leaf...
Q704I2  81 DVFQDVARLQDFLERGYDSFRSVLGIHLLEHERLVSRILEQPVMEPDQAVRLCFHYHNALDHDDDDSGLETDFNNLSLGR 160 Sugarcane yellow leaf...
Q2L3I0 148 DVFQDVARLQDFLERGYDTFRSVLGVHLLEHERFVSRILEQPIMEPDQAVHLCFHYHNTLDHDDDDSGLEADFNNLSLGR 227 Sugarcane yellow leaf...
Q9JH80 148 DVFQBVARLQDXLERGYDTFRSVLGVHLLEHERFVSRILEQPIMEPDQAVRLCFHYHNTLDHDDDDSGLETDFNNLSLGR 227 Sugarcane yellow leaf...
Q70AF4 161 PYINGLPPNEKIIFIHSNLVGRSTYSHDI 189 Sugarcane yellow leaf virus
Q704K6 161 PYINGLPPDEKIIFIHSNLVGHSTCSHDI 189 Sugarcane yellow leaf virus
Q704I2 161 PYINSLPPDEKVIFIHSNLVGHSTYSHDI 189 Sugarcane yellow leaf virus
Q2L3I0 228 PYIDGLPPNEKIIFIHSNLVGHSTSSHNV 256 Sugarcane yellow leaf virus
Q9JH80 228 PYINGLPPNEKIIFIHSNLVGYGPSSHDI 256 Sugarcane yellow leaf virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap