Conserved Protein Domain Family
DUF3038

?
pfam11237: DUF3038 
Protein of unknown function (DUF3038)
This family of proteins with unknown function appear to be restricted to Cyanobacteria.
Statistics
?
PSSM-Id: 402703
View PSSM: pfam11237
Aligned: 57 rows
Threshold Bit Score: 134.222
Threshold Setting Gi: 123160727
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012627273       30 PRRTRWQIDLILLALEALDLGGSEAMLALAKELQVQHLIPNRVVLWRLRCTNPFRRFSl----gQRRSLSLEELKALVAI 105 Cyanothece...
jgi:PCC8801_0904   28 LDKIKTHLDLVLLGLEALTKINSSDLVSVAQDLGLNIIKVQKWQLWQQRQLSGISPTEe-----TPTPLTIEEARSQIII 102 Rippkaea o...
wustl:cce_1894     25 LYQMQTHLDLVLLASECLIPIDADMLLQAALDLDVNTTLVEKVHLWSNRDTTQENHPL--------NSFTVEQLRSLILI 96  Crocosphae...
jgi:UCYN_10610     28 lnnVHFYLDLVLLASESLIPITTDMIFQSSLDLGMNTYLTKEIKLWSGQDVKKSRDFL--------EGCTVKQTKLSTIL 99  Candidatus...
Q111P6             32 LDKIRTKLDITLLALKVLIGINSESIVRVASQLNISTKIADQLSL-VVETEKGLKSVVl-----QNQPLKVEEAQSFVLI 105 Trichodesm...
P74427             25 LRQMNCYLDQLLLALVALTDVDEDTWTAILEKISSSTTTGQSLT----------RKYPip--avAPGQLDVEGIRLLAMA 92  Synechocys...
jgi:Cyan7822_1686  28 LDNIRAYLDLILLALEALAKIDSDTILNTAQELSLESIFSDHIALWQLRAANPLRKNSg-----ERKNLNVEEARALVLI 102 Gloeothece...
Q8DIU7              4 slPIKAQIDLILLSLEALAHVGSAEVLALAETMGFEAYLPDRVGLWRLRQSSPLRRGRn-----GRRKLDVDEARALALI 78  Synechococ...
jgi:Pse7367_3130   24 LHQIKAHLDLVILALEALTGIGSEAILQAAQDLQLQEVLGDRITLWRWRQANPLRKGKg-----GRKKLDVDEARAMALI 98  Pseudanaba...
WP_015167429        6 LYQIKAHLDLILLALEALTEISSETMLQAAVELKLHNILSDRLVLWRLRQANPFRKGSsgkttsGRKKLDVDEAKAIALI 85  Synechococ...
WP_012627273      106 GCTLARRQTVLIRQLLMEYQQLKQQELPLDNSPHLSYYLERFRSHFRSRMNYKRTAIAAY-KDPEKLNALGLHLLEQLLF 184 Cyanothece...
jgi:PCC8801_0904  103 LCHLCQQNQELIRRAVTLLEQMMTQNKDPLRIGLLQEYCESFNHLYQGGT-TESSS-----LSTEQLAKLAFKLLVDLLF 176 Rippkaea o...
wustl:cce_1894     97 LCYINQQHQELIRRAVTLLEQMTVQHKDPAQTTLLGNYLENFKDFYSKRADHPK-------LLPNQQVELASKLLIDLLF 169 Crocosphae...
jgi:UCYN_10610    100 ICCVVGQHEELIRRAITLLEQMTQQNKDPKQSTLLGKYFSNFSYYYKYKVKENKK------LSIDEEFQLASKLLLDLLF 173 Candidatus...
Q111P6            106 ICHLAKQNQGLIRRAVSLMEQIDSQNSKLQSVTLLREYLYDFKEVYQNYY-WDRGS-----TTPYKSETLALKLLVDLLF 179 Trichodesm...
P74427             93 IAYLGAHYQELLRRSVSLVEQTKEQGKNPLQTVLLSEYARKFTSAWQA-YGEKQGGEAHIpLAPITSDRL-LSLLTELFF 170 Synechocys...
jgi:Cyan7822_1686 103 ISHLAKQHQELIRRAVSLLEQTVADNKDPHHSALLSDYLDIFSKLYQERM-ENSEN-----VSPQQLFSLAYKLLVDLLF 176 Gloeothece...
Q8DIU7             79 CTRLAQQHQPTIRTAIESWQQQTSEGRPPHLDPVLGDYIDRFTRLYQDRM--AHDS-----SDGTELAQLALDLLVDLLF 151 Synechococ...
jgi:Pse7367_3130   99 SSHLAAQKQTEIRNAIGQLESCSAQNRLPYQAPILGDYLDAFNNLYGDRMNIDQSQ-----IVNSVLEKLALKLLIDLLF 173 Pseudanaba...
WP_015167429       86 TSHIASKEQRTIREAVAELEKCTLKKASPHQQRILGDYLDRFYSLYEERM---AEA-----TSNQNLENLALKLLIDLLF 157 Synechococ...
WP_012627273      185 CTGTAGTERLWVSLFD 200 Cyanothece sp. PCC 7425
jgi:PCC8801_0904  177 YSTPDGHRRLWLAMLD 192 Rippkaea orientalis PCC 8801
wustl:cce_1894    170 YSEDNGYDRLWLALLD 185 Crocosphaera subtropica ATCC 51142
jgi:UCYN_10610    174 YSSDSGYIRLWSTsln 189 Candidatus Atelocyanobacterium thalassa isolate ALOHA
Q111P6            180 YSAPQGCNRLLLSLkl 195 Trichodesmium erythraeum IMS101
P74427            171 FSSQDGPRRLWGVLAt 186 Synechocystis sp. PCC 6803
jgi:Cyan7822_1686 177 YSGFNGYRRLWLALLN 192 Gloeothece verrucosa PCC 7822
Q8DIU7            152 YSTPQGARRLWITLLE 167 Synechococcus elongatus
jgi:Pse7367_3130  174 YSAPTGSRRLWVALLE 189 Pseudanabaena sp. PCC 7367
WP_015167429      158 YSSVTGSRRLWMSLLE 173 Synechococcus sp. PCC 7502
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap