Conserved Protein Domain Family
Med25_SD1

?
pfam11235: Med25_SD1 
Mediator complex subunit 25 synapsin 1
The overall function of the full-length Med25 is efficiently to coordinate the transcriptional activation of RAR/RXR (retinoic acid receptor/retinoic X receptor) in higher eukaryotic cells. Human Med25 consists of several domains with different binding properties, the N-terminal, VWA, domain, this SD1 - synapsin 1 - domain from residues 229-381, a PTOV(B) or ACID domain from 395-545, an SD2 domain from residues 564-645 and a C-terminal NR box-containing domain (646-650) from 646-747. This The function of the SD domains is unclear.
Statistics
?
PSSM-Id: 402701
View PSSM: pfam11235
Aligned: 2 rows
Threshold Bit Score: 171.497
Threshold Setting Gi: 158706143
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q71SY5       228 LPVGGGSAPGPLQSKQPVPLPPAAPSGATLSAAPQQPLPPVPPQYQVPGNLSAAQVAAQNAVEAAKNQKAGLGPRFSPIT 307 human
XP_006107348 228 LPVGGGSAPGPLQPKQPVSLPPAPSSSAALSAAPQQSLPSVPQQYQVPGNLSAAQVAAQNAVEAAKNQKAGLGPRFSPIK 307 little brown bat
Q71SY5       308 PLQQAAPGvGPPFSQAPAPQLPPGPPGAPKP-PPASQPSLVSTVAPGSGLAPTAQPGAPsMAGTVAPGGVSGPSPAQ 383 human
XP_006107348 308 PSAAGAPGxGPPFSQAQAPALPQGPPGAPKPvSPLPSPTWSPRWLPVQGLAPTAQPGAP-QAGTVAPGGVNGPSPAQ 383 little brown bat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap