Conserved Protein Domain Family
DUF2996

?
pfam11210: DUF2996 
Protein of unknown function (DUF2996)
This family of proteins has no known function.
Statistics
?
PSSM-Id: 402680
View PSSM: pfam11210
Aligned: 36 rows
Threshold Bit Score: 158.187
Threshold Setting Gi: 81577593
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_009554682      32 LEDKPFATFIQDDFLPALKTGLEQQGISGVELSFEKAAIAVKGFSQyPPCSQVVGRWNSGykqPRQFNLYFFDDDINGKK 111 Oscillatori...
Q31LY1            26 LEDKPFKEFVQTDLLPAVQQALSDRGLADLDLQFVEAPLPVTG----DRCWQLQGSWAKG---QRRFLLGFSEESLTAPK 98  Synechococc...
CAK28380          30 PEDKPFAEFVPQLLMPALAKEIESYGGPAPALELEQAAMPVVG----ETCWQIRGELPGD----RRFWLCFTKDDIQAPK 101 Synechococc...
jgi:Cyagr_0707    30 PEDKPFEVFVPELLLPALVKEIEAYGGPAPELTFEQGAMPVVG----ADCWMVKGRLPGE----RRFWLCFTRPDISSAK 101 Cyanobium g...
Q7V7H7            52 VEDKPFETFIRDDFLPNIKQALTERGMPPSTLELIQGDRPVVG----DPCWMVCGEIPLG----RRFWLCFASDSIASKK 123 Prochloroco...
WP_011933011      28 LEDKPFASFMQEDFLPSLTKALDDRGQRAVSLSLIEGERPVVG----GSCWMVKGELSGE----RRFWLCFESDAITSGK 99  Synechococc...
Q46KX3            66 LEDKPFKEFISNFLIPGLKASIEDKGTVVCEIKLIEGQRPVVG----GNCWMVFCELSEQ----KKFWLCFSKDIITSDK 137 Prochloroco...
jgi:Cal6303_3631  50 VEDKPFLDFMQQDYLPALQQAIASEGVRDLQLNFAKQKVPVRGMQNaDECWQIVGSWQNG---NRQFNVYFPDEDIQGKK 126 Calothrix s...
WP_015217284      40 VEDKPFEEFIQQEYLPALQKAIVAEGVPDVELTFAKQKYPITGFNSaEECWQIIGSWQEG---QRQFNVYFPDADIQGKK 116 Anabaena cy...
jgi:Chro_1310    128 VEDKPFTEFIQQDYIPAIEKALKAQGVVDVDLTLTKQKIPVVGLEQ-QECWQIVGKWQNV---SRQFNLYFPDEDIQGKK 203 Chroococcid...
WP_009554682     112 GFSYSESDSQASTLESFRIDERKSDLGLLVFWTLQRLNAQKWLV 155 Oscillatoriales cyanobacterium JSC-12
Q31LY1            99 VFSLADGKATPATLEAFLGDERKITLPLLLNRILSRLNGQKWLE 142 Synechococcus elongatus PCC 7942
CAK28380         102 TFAIAESGAPPSLLESFLIDEKRITLALLVSRTVQRLNGQKWLG 145 Synechococcus sp. RCC307
jgi:Cyagr_0707   102 TIALTEGAGSPSLLESFLIDEKKMTLSLLVSRVVQRLNGQKWLG 145 Cyanobium gracile PCC 6307
Q7V7H7           124 TISLAETGTEPSLIEPFLIDEKKMTLTLLRSRLLQRLNGQKWLT 167 Prochlorococcus marinus str. MIT 9313
WP_011933011     100 TIALAESGTAPSLLESFLIDEKRITLALLQSRLLQRLNGQKWLG 143 Synechococcus sp. WH 7803
Q46KX3           138 TILLAESNSDPSIVESFLIDEKKTTLPLLISRVLQRLNGQKWIG 181 Prochlorococcus marinus str. NATL2A
jgi:Cal6303_3631 127 GFSCNE-GRVPSTLESFLIDERKVSLDMLVNRLVWRLNGQKWLG 169 Calothrix sp. PCC 6303
WP_015217284     117 GFSCNE-GKKPSTLESFLIDERKITLDLLVSRLVYRLNGQKWLG 159 Anabaena cylindrica
jgi:Chro_1310    204 YFSCNE-GSRPSTIEHFLGDERKMTLDLLMWGIVQRLNGQKWLS 246 Chroococcidiopsis thermalis PCC 7203
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap