Conserved Protein Domain Family
DUF2989

?
pfam11207: DUF2989 
Protein of unknown function (DUF2989)
Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed.
Statistics
?
PSSM-Id: 371419
View PSSM: pfam11207
Aligned: 23 rows
Threshold Bit Score: 240.632
Threshold Setting Gi: 504058955
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q12NA0         14 LFGCENDR--NTDVICKNNPELCVDLHRDSWCLYEKASLIRHRYALKQTEVHTGKqlYQQLIMLENYSKCIELAAGVQHI 91  Shewanella den...
WP_014292949   55 LAGCERD---RTSGLCGRFPQFCADLHDDSWCTRERNGLVEARYEHAERPGDASR--YRLMSSLEAYRLCLDPLLDIQYT 129 Oceanimonas sp...
tigr:AHA_3360  19 LTACDDDR---IHNICANYPALCQDLVDDGWCRYERSDIIRARYYLQAEGTQRRQ--YELMRSLERYLKCAERSTNIEYK 93  Aeromonas hydr...
WP_015464879   18 LFACLPEKkdDLLSICNASPELCEQFHDIGDCRYKRTSLIRALYYKELDPESKSS--SPLLEALEGYESCLEPRLFIEFS 95  Psychromonas s...
Q8EEN2         17 LFGCDNGR--NIQTICKNNPEICADLHKDGWCLAEKTKLIQSRFDLIGHNNPTGKqlYQQLTYLEDYSRCIELASGVQHI 94  Shewanella one...
WP_011759920   14 LFGCDNGR--NSDTICKNNPELCEDLHKDSWCRYEKGDLIRQRFILKTTPNPTGKqiYDQLRFLEVYSKCIELASGVQHK 91  Shewanella ama...
Q082M8         20 LFGCDNDR--NSDLICKNNPELCSDLHKDSWCRFEKGDLIRHRYALKQSSSPTGKqlYQQLVYLENYSKCIELAAGVQHK 97  Shewanella fri...
WP_013051431   20 LSGCEKQL--DTGSICKNNPELCSDLHADSWCRYEKGDLIRKRYELKFTQSPSGKqlYEQLLNLEKYNKCIELAAGVKHI 97  Shewanella vio...
WP_011865799    9 LFGCDNAA--NTATICKNNPELCDDLHRDSWCRYERADLIQKRYTLKNTPSPTGKqiYQHLINLENYSKCIELAAGVQHI 86  Shewanella loi...
Q5QX53          1 -----megkpSVSKICESTPGICSDLNTDNWCNVERSEFIYSRYERSLNDTSENQ--YFVMRDLEKYSKCIELAATLEMT 73  Idiomarina loi...
Q12NA0         92 IHTERTLDRKRAFAVSTQNLAQLQEFTKDNQDIYLAFYRWMRFGEQAAFMLVNNAFKQGEIQEVEILQQLAVHYLKIDAN 171 Shewanella den...
WP_014292949  130 KRHERKNTKVEAIIDIGEELARLEARTASSDYPYLQLWRWQRHGDRAARNAFIEQAGRPEMQQADLQQALAGLLLQRDPA 209 Oceanimonas sp...
tigr:AHA_3360  94 RAREQKSPRVEGMLAAGEQLAQLDAATRNATDPYLLLWHWTNNTNELARQQFLALEGQPVLEEPELQLALGGIYAKSEPQ 173 Aeromonas hydr...
WP_015464879   96 KRKERKTQRIENYLHTQKLIEEELINSKGTKDPHLAYYLWTRYKDVSAKKVFLKAANDPNLNDISLLTKLATFYYKRKPQ 175 Psychromonas s...
Q8EEN2         95 IHTNRTADRARAFRLSTQNLSQLQDDTRERQDPFMSYYQWTRFGDTQALNRLLAQESAGEVTEPFLLAQIATYYSSRNAI 174 Shewanella one...
WP_011759920   92 VNVQRTNDRLRAFGISVQNLEELQESTKGSQDPYLAYYHWSRLDDAKSLAVLIKAEKEGQISDPELLSKLAIYYLKTDAA 171 Shewanella ama...
Q082M8         98 LNTDRTRDRERAFAVSTQTLSELQEFTRTNNEVHLAFYRWMRFNDQDSFTIVEDTYKQGVLTDNDIITQLAAYYVRVSPN 177 Shewanella fri...
WP_013051431   98 LHPERSNDRVRAFGLSAQTLSQLQDTTKNSQDLYLAFYHWTRFNDIEAQKIVLAAYKNHQIDDILLLSRVASYYQKFDAL 177 Shewanella vio...
WP_011865799   87 MHPERTNDRVRAFGISAQNLAQLRETTKDNPDLYLSYYHWIRLNDQAALSRVIKAQQAGSIKDLEILASLASYYQKSDLD 166 Shewanella loi...
Q5QX53         74 KSKQKQSDRLEAFINSRKNIEKLADETADSEHPLWLYWHWANRSDHEALDKLLALEGSKQMETPELKLALATYYTKKDSE 153 Idiomarina loi...
Q12NA0        172 ISKDIYRQMFAAITSEdlihsddneismDlthEFNPDWLLGLANVHQQQQNFAKVYLLTK 231 Shewanella denitrificans OS217
WP_014292949  210 AAERALHRSLELSGAD------------H---KPDASLLASLVDLYIRQKRYEEAWIWAg 254 Oceanimonas sp. GK1
tigr:AHA_3360 174 KAIALMQHALSLYREG------------E---QVNGRILTSLSTLYMGQKQYGQAYLWGK 218 Aeromonas hydrophila subsp. hydrop...
WP_015464879  176 KALKLFYRVLQQSHSL------------D---DISIDVFSYIMTIYYSNKQFEQAYIWAY 220 Psychromonas sp. CNPT3
Q8EEN2        175 KAQQLYLKVFASIQFD----------------DFDPSWLLGLASTYRQTQQLDKTYMLTK 218 Shewanella oneidensis
WP_011759920  172 RAKKLYLDVLGMVDAD----------------HLDPDWLLGLATASRTLGDLDGSYLYSR 215 Shewanella amazonensis
Q082M8        178 DAKTLYLHLLATTEPA----------------KIDPDWFLALASIYRQQQNAEKEYLLTR 221 Shewanella frigidimarina NCIMB 400
WP_013051431  178 QSNLIYLQVLDLSNKD----------------NFNPDWLLGLSNNYQKLKDLELTYLLAR 221 Shewanella violacea
WP_011865799  167 KAKALYLQLLDSADPD----------------SFNPDWLLGLASIYHQQNDLEKTYLFSK 210 Shewanella loihica
Q5QX53        154 KTFELLYSALRLYRPD------------D---KVNPEIPSTLVSMYLKEGNGPEAYVWSQ 198 Idiomarina loihiensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap