Conserved Protein Domain Family
DUF2981

?
pfam11200: DUF2981 
Protein of unknown function (DUF2981)
This eukaryotic family of proteins has no known function.
Statistics
?
PSSM-Id: 402672
View PSSM: pfam11200
Aligned: 5 rows
Threshold Bit Score: 369.697
Threshold Setting Gi: 675129980
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_012768082  24 RNGLFFIAIQQFLLGVSLYSVIHYLHPSLTKLAWLLFGVNAISAVLG----------FLGALKRSMVIECVYLVFYFISL 93  Babesia bigemina
EDO06818       2 SQGLFYIAIQQFLLGISLYSVIHYLHPSLTQLAWLLFGTNAISAVLG----------FMGALKRNIVMECVYLVFYAISL 71  Babesia bovis
BAM38801      23 RNGVFVTSFTQLLFGVALYCILHYLHPSLHGVAWFLLGLHVLVAVLGyvflclklcrFVGALKRSLGFHATYMVFYAVSM 102 Theileria orien...
XP_008886877  19 RRGLFLIAFIQLLTGIAVYLCYKYLRPSLHAVASSQLIIFSVSAVIG----------ATGAYRRNTTVEGFYFATFLASI 88  Hammondia hammondi
ESS34290      19 RSGLVVIAFVQILTGVSLYLALGYLRPSLHGAAYFMLLTNIASALLG----------TWGLWRRNQCVETIYLATYLACL 88  Toxoplasma gond...
XP_012768082  94 TLVFLTVLDMAELVHLLPKAPQIRDVSDFgalrsaaflraggMKPHVFLRQRDMPldlgedd-------fstqgdDDLEI 166 Babesia bigemina
EDO06818      72 FLIFLTVLDMAELVHLLPRGPQLKDVSDFasirsaalpstalMRSNAFLRQRELPyafdqndslelgdsfpalvsDDNKT 151 Babesia bovis
BAM38801     103 VFVAMIALDMSELVHFLPKAPQMHDFSMF-------------QTNTPLITKFKSP--------------------NSKVL 149 Theileria orien...
XP_008886877  89 AFLIIAILDFTDVVHMMPKAPE--------------------GATEAFLQIDRET------------------------- 123 Hammondia hammondi
ESS34290      89 SFLVITVLSFANVVQALPKAPA--------------------GVSEGFTQLDKLP------------------------- 123 Toxoplasma gond...
XP_012768082 167 NPDDDSKLRNDgHNALPTdv------diAPLRSPdldrQQEISPAKqqrQHVvdesgRSDVATPAavatNNAEGAT--VD 238 Babesia bigemina
EDO06818     152 LEDSISTASTDaEDNIPS----------KNLRMP----QTEEMPIN---QHV-----GNDLNMPG----NGAMPISgnID 205 Babesia bovis
BAM38801     150 FPFNFYKDPFL-TNNMPDlsdlgngkliAKYSVTeidlHNPQNPIVsysGTIsn--ePFDANSPNgnmdGTTGLPTsaGD 226 Theileria orien...
XP_008886877 124 -----------------------------QNRPS--------------------------------------------SV 130 Hammondia hammondi
ESS34290     124 -----------------------------HFRNP--------------------------------------------IT 130 Toxoplasma gond...
XP_012768082 239 SDLRDLEANRNATTT------------------TAPKRgrdNANVHVPKALAAP-TKENEVTADSLPAQAEvadsvEPAK 299 Babesia bigemina
EDO06818     206 AVTGNLEPASKAIQQ------------------TTPNV---NESMKIPNEMPMPyGNSKEAKSAELPIAIP-----EQTV 259 Babesia bovis
BAM38801     227 AGLDDLDKLKKLLREklndsnptnstdnnsgprSDTAYpvgATPSSSPTTATTPdNNPTSSPTSAPTATPD-----KPAS 301 Theileria orien...
XP_008886877 131 AARRWHYSHGSFVAN------------------TSRLTpggWASKQDIQKA----------------------------- 163 Hammondia hammondi
ESS34290     131 SYISEADQHAMLI--------------------------------QILQHSTLPeLKMPEMEIPSLPKMPG-----IPN- 172 Toxoplasma gond...
XP_012768082 300 epNAEDAKMESFYDRLPLVPHLGETEGEAEEVSKEELPPETHDLTPEGISEVVAIYKIQKRPLKMAAAGLTTMALLFNIY 379 Babesia bigemina
EDO06818     260 akNTYDAKTETFYDRLPLVPHIGETEGEAEEVSKDELPPETHDLTPEGVSEVVAIYKIQKRPLKMAAAGLLTIALLFNIY 339 Babesia bovis
BAM38801     302 --QSGGDKDDSLYDHIPFLPHPGETEGESEEVSKDEFPPETNDLSPEGKSEVVVMYKMQKRSVKFAASAFLLVCLIFYMY 379 Theileria orien...
XP_008886877 164 ------------LETLPFVPHIGETEGESEEISIGELPPEAKELPTNAQNMVIAITKMQKRPVKLAFAGVFGTLLLLHLY 231 Hammondia hammondi
ESS34290     173 ------------YEDIPFVPHLNQTEGETEELSAGELPPEAQNLTHQQQEEVTALVKMQKRPVKLAFAGVLGLLALFQLY 240 Toxoplasma gond...
XP_012768082 380 CYWVAVTFVLNKCTCLDELVSHPEQFTPLID 410 Babesia bigemina
EDO06818     340 CYWVAVTFVLNKCTCLDELVSHPEQFTPLID 370 Babesia bovis
BAM38801     380 SFWVAFTFAMNKCTCLDELSAQPDQFTPLVD 410 Theileria orientalis strain Shintoku
XP_008886877 232 FGWIILTFLMNKCMSLDELTGQPEQFQPLIR 262 Hammondia hammondi
ESS34290     241 GIWIIITFIMNKCMSFDELAGAPEQFRPLVG 271 Toxoplasma gondii VEG
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap