Conserved Protein Domain Family
DUF2960

?
pfam11173: DUF2960 
Protein of unknown function (DUF2960)
This family of proteins with unknown function appears to be restricted to Gammaproteobacteria.
Statistics
?
PSSM-Id: 402649
View PSSM: pfam11173
Aligned: 16 rows
Threshold Bit Score: 108.177
Threshold Setting Gi: 372983554
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8EH58             1 MARQVTYTFKGETKTIAFSYAKHHDLYEAVAEAEGIDLTKFLAMEQQIAMTSrKGAKAEKDYRKVEFARFGFSNIHFVRD 80  Shewanella ...
WP_011758916       1 MARQVAYTYKGQAKVINFAYDKYHDMYEAAAAAEGVDLTRFLAMEQQVAMTA-KGKGALKSYRLNEFARMGFKDIRMLRD 79  Shewanella ...
UNSW:PCNPT3_06800  1 MSRQVTYIFKKERKTILFTYAVYHDIYEAVADAEGIDLTAFLAQEKQLEMSC-RGQGIVKNHRQTEFLRMGFKDIKFVRE 79  Psychromona...
ABM04328           1 MARQVTYEFKGKRKTIQFSYNQFHDMYEAVADAEGIDLKSFLAMEKQLAMSC-RGQGIEKNFRLTEFLRMGFDKIKFVRD 79  Psychromona...
IBRC:GU3_00235     1 MAFRIRYHYRKQQKEIGYANDKHHSIYDAIASAEELDLAEFRRMEDQLANISrNDRKTMKEFREEYFRKLGFSQITIFRD 80  Oceanimonas...
WP_011707214       1 MAFKITYTYGKKTKEIGYANDKFNSIYDAIAAAEGINLASFHAMEEQLAQVCrRDKKSVKDYRENYFKELGFSNIVIERD 80  Aeromonas
WP_013343924       1 MALKLQYTYKGHTKVVGYANDKHHSMFEAAAAAEGLDLKRYQMLEQQVQMST-RDKKAHRDFRDNYFRDLGFSDIQVIRD 79  Ferrimonas ...
jgi:Tola_0468      1 MALKISYSYKGQPRLIQYANDKYHDIYEAIAAEEGVDLRAYLAMERQLASLT-KKVGAVKDFRDNKFLEFGFNDIKVIKE 79  Tolumonas a...
Q5E076             1 MARIVRYTYKSETKEIPFSFREFHGPFEAAAAAEGIDISDFDTMLKQVEMAS-NNPGAVKDFRHSYFTKLGFSKVRFVKE 79  Aliivibrio ...
Q6LK63             1 MARTILYTYKEEEKELTFSYQEYHSIQEAVAAAEGIDITAYLKMEQQIEAVT-RDKKAVRDYRDNHFRKLGFGRITLAQK 79  Photobacter...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap