Conserved Protein Domain Family
DUF2955

?
pfam11168: DUF2955 
Protein of unknown function (DUF2955)
Some members in this family of proteins with unknown function annotate the proteins as membrane protein. However, this cannot be confirmed.
Statistics
?
PSSM-Id: 402644
View PSSM: pfam11168
Aligned: 21 rows
Threshold Bit Score: 76.488
Threshold Setting Gi: 81442173
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011759117  23 PILRIAVAALVPLFVLHYLENPLPMLVSVFAVIMLtLMPGRPSLQVLSKLSMVVVAAAMVQHAAGILLSGTGTGSWMFLF 102 Shewanella amaz...
Q7MC98         2 KTQRIWFGCASGLALSMLFGWSYGFFAIMLPLFIL-SRTDSFQLSRLLMVIFSAVWTTVQATFLLEYLQFHPVLITVAVG 80  Vibrio vulnific...
Q87N85         2 KTLRIWFGCSLGLALSMIFGWSYGFFAIMMPLFIL-GRMDHFNLAALLIVFFSAVWTTIQATFLLEYLQFHPTLMTVAVG 80  Vibrio parahaem...
Q7MG20        39 PLLRVAMFPVLLLFWQYVFGTDLPLLAPAMCVVFLtTTHEPPPLAMILVMGGILFITAWVQAFVSNLLIDYPQVYYLFLF 118 Vibrio vulnific...
Q0K914        19 RSLRVASGTALCLAASFGLGLPIPMLAPVLGVFLLaSVNQPVSPKAGLGLVLVVMLTTGTGLLLIPMLRYYPVSGVLMIG 98  Cupriavidus nec...
Q88PY1         9 RALRLAWGVALCLAVSFGIGLPVPILAPVFAVLLLaMRSQPLPLRAAPALALLVLLACGSGLLLIPLLRHAPLAGVLLVG 88  Pseudomonas put...
Q1LMN3        21 RALRLAVGTALCLATSFGFQWAIPMVAPVLAVFLFaTVGRPLPAKAGLALALLVIATTGTGLLLIPFLRHAPLSGVLMTA 100 Cupriavidus met...
Q47WK8         2 RVLRFAFGVTLSCGLAYGINWPLAFLMPVFTAMILaMPLPKPSVKASFNNMMSTLKAFAIGLAFSLFFLQYPIVYLIALA 81  Colwellia psych...
WP_012600930  14 RILRFTVGVTLAVFLAAWINWPLAFVAPVFTAKFL-IDKSNLHKETVYELLLAVVVTMGLGLLLSRGITHYPIPLLILVG 92  Vibrio tasmanie...
Q6LGC8        25 RIFRYVLGLVVACALALGIGWGLSFVAPVFLAKFL-VDHQKPTSHTISQLLLAMTVTVLIGLSVSAGITHYPLPLLLLLS 103 Photobacterium ...
WP_011759117 103 AVLFYSLSRIHLNPKDIVGTMMMILGIMVTILHWQFATTVSDLPLVLAANFVGAIVMVYLV 163 Shewanella amazonensis
Q7MC98        81 LFFLIKCIAMMNPNTYLFGYMGLLVGSIVLNFASYDFIDIEDFNLNLWVISLANIAICALA 141 Vibrio vulnificus YJ016
Q87N85        81 IMMLFKCIAMMNQKTYLFGYMGLLVGSIVLNFASYNFMDIEEFNVNMWVMAFSNIFVCAFA 141 Vibrio parahaemolyticus
Q7MG20       119 GVFYWCMERTKKNSQDVLAILLIVSTAMIAVFTQQKGIDVEQIPFALLANIFIAGFTAYLA 179 Vibrio vulnificus YJ016
Q0K914        99 LCLFLAFSYGLRGGNNLVSTFLVIGLTMISAAGTFDFGLAVMVIGALVKGLLVAVVVLALC 159 Cupriavidus necator H16
Q88PY1        89 VGVFLTLRYALKGGNGLLANLLVVGLTMIAAAGTSDFTLALSVVEALAKGMLLAVLGTSVV 149 Pseudomonas putida KT2440
Q1LMN3       101 LGLFLAFRYGLRGGNGLVSTFLVAGIALISVAGTADMGLALSVIGALARGLLLGVVMLAVC 161 Cupriavidus metallidurans CH34
Q47WK8        82 LVLFHLYYYLNRGGSFWFTLMSMIAILVLPMIANSNEGLAIGFSAGFVYSSWLTIAMLWLA 142 Colwellia psychrerythraea 34H
WP_012600930  93 LMMLWGYYLFVDPKWNLFATILLIAVLMLPFMAIDNPGVSVLLASGLATSGVVSVTIFALV 153 Vibrio tasmaniensis
Q6LGC8       104 LLMFTAYYLFMDPQWNFFATILMIAVMLLPFMGIISPSLAVYIGVGLTTSGVVAVllfgll 164 Photobacterium profundum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap