Conserved Protein Domain Family
DUF2913

?
pfam11140: DUF2913 
Protein of unknown function (DUF2913)
This family of proteins with unknown function appear to be restricted to Gammaproteobacteria.
Statistics
?
PSSM-Id: 402622
View PSSM: pfam11140
Aligned: 19 rows
Threshold Bit Score: 157.895
Threshold Setting Gi: 81398134
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAV19034       20 KYYIEIQKLVNDALGELYALHKAGKAIDAPIANNLYLVRWVTKAIKAQSYDRVIVPDLVRWQKQGRSKGNNSDLTFTFKR 99  Vibrio tasmani...
BAJ00818        4 RYNQALIEITQAGLAALEERSKSNNVVKTAAAESHFLCNWMAQALKERRFSKLIAKELTKWVSDARSMGAAAQLPALLQR 83  Shewanella vio...
jgi:Shew_0948   5 SYNQALVALAQAGLADLAARNANPGSIKTPAAESHFLCNWMVQSLKERRFSKLVADDLTRWIREGRSKGAGAQLPQLLQR 84  Shewanella loi...
jgi:Sama_0806  10 NYNASLLAMATAALNALD-SSHAGAAHATEAQQSHFLCNWMAQALKDKSFDKAIAGELTLWVRQGRSMGSSAQLKRLLQT 88  Shewanella ama...
Q6LWA8          5 KYHQQLSDVIENSLLHLYGQVASNDRFVPLARRNDIVCKFLKPKLKQPCY-KSIKGDIKRMILVGQ--RKDGDLEAKLNE 81  Photobacterium...
Q6LIG1          2 N-STLLLDITTHALLHIEFCNLDKKL--TIADRNVKLNQFLKRAIKSNRY-KRIKKNIKQWLTVAK---LNDGLESLL-- 72  Photobacterium...
Q7MF69         13 DANQLLSELAVHALLHLQFRRLATPNLYSRQESNDILQKWLKPKLKSNRY-KLIKKPLKAITQQAK--GESGDLEALLER 89  Vibrio vulnifi...
ABM03590        3 QFSTEIYKLITTALTELSDSHDSGRTPHNPLSEAHYLGAWITTAMKKKRFDAIVAPTLQVWQRQARSLGKNAGLKRQFTY 82  Psychromonas i...
Q8EH50         46 TYNQAILELALAGLADLTTSAQAKKAQRTPAQESHFLCNWMVEALKEKRFSKLVAEDLTAWIRMARSQGAGAELKRLLER 125 Shewanella one...
Q086M9          5 TYNQALLTLALAGIEAINTSASQHKAVRTPAQESHFLCNWMVESLKTKRFSKLMADDLTAWIRQARSQGAGAQLKRLLIC 84  Shewanella fri...
CAV19034      100 ISAFYgRFFPEGEEPkalkDSDVEAFMDKMYEMGW--SVSSEDELTTggKIQFFTDGEHSFALCGKQCDDSFD--GelMV 175 Vibrio tasmani...
BAJ00818       84 IESQY-LAAEGKQTL----GASLNAMLSELRENDW--VVILDCEVTT--KLKLDCSGQNSLVISDEQYDGHIDgdK--LT 152 Shewanella vio...
jgi:Shew_0948  85 IETQYlPAMENA-EV----GQSLQALIADLEAQGW--LVILDCEVSG--KLRLDSDGQNSLVISVEQYEQHLVegK--LI 153 Shewanella loi...
jgi:Sama_0806  89 IRHQYsTLAEHTMGL----GNALAKMLEDARQQDV--IVYTDTPVKT--KLKLDADGQSSIIVCADEYQQHIRdgE--LI 158 Shewanella ama...
Q6LWA8         82 LHSMSvDFQKKANDA-----QKLFDLLSILLSKHGfdSKIFDESAQA---------EPEVIYVLQDHLENCFEdnGt-QI 146 Photobacterium...
Q6LIG1         73 LSEQMkLIENCSTDM-----HRFVELISMVESQLTtkVQFANARELD----LQARFGQVLVCVIESDLQAIFDeeGl-MI 142 Photobacterium...
Q7MF69         90 CVGA--ESAPVQPHL-----DSYLLLINEIEKKLGttVLLSRAEDVD----LSHDENGCLLCVLTQNLNEHFGsnNe-MR 157 Vibrio vulnifi...
ABM03590       83 LEKCYsEVMDEQKEVrpvnKSQLEKLFAGLEEDQW--LVTTDLPVGE--RLNRHSGGKESLIVCAQQLLDCFDeqGt-LI 157 Psychromonas i...
Q8EH50        126 IVYQYqTVENSPLEL----GSALNAMIAELTEREW--LVFTDTEINT--KLKLDGDGQSSLVIDVKEFTQHIQdkQ--LI 195 Shewanella one...
Q086M9         85 IADQYqQANNSEIAT----GTGLKNMLAGLTAQEW--VVITDTDIDA--KLKLDSDGKSSLIISAKDFNQHIVdeK--IV 154 Shewanella fri...
CAV19034      176 KPMNWFVRGNHAE---FIQAAMEAGFMLHKVTDYKSAVKYHGEYIVYPANQGNQLAEIP 231 Vibrio tasmaniensis LGP32
BAJ00818      153 KTITLYVRANEQE---FAKVAAKHGLLLSQGNKKSSLIKHHKAYLICPGNQQPAMALLV 208 Shewanella violacea DSS12
jgi:Shew_0948 154 KSITLYMRADEQL---IAQHAVKHALLLSQGDKKASCIKHHKAYRLYPGNRQPALALLQ 209 Shewanella loihica PV-4
jgi:Sama_0806 159 KPISLFVRADEKF---LAKLAFSHGLMLTQGDKKSSLIKHHKSYKLFPKNQLPSLALLT 214 Shewanella amazonensis SB2B
Q6LWA8        147 APVSMLIESDRSLe--LIEFINATQLFSAELKESDS-------------NNQQSHILLH 190 Photobacterium profundum
Q6LIG1        143 KTTQILFIGSPEYkdiFSEQIDKSDHFQSVLAYEDE-----------------THLRVE 184 Photobacterium profundum
Q7MF69        158 SPISMLFRGPMSQralFLGAIYANNTFTYSVGYQDE-------------QFVRITLELA 203 Vibrio vulnificus YJ016
ABM03590      158 KPISLYIRGTLPK---IIDLAFAQDLLLHKITDYKSKVKYHGEFIVYPNNDGRSLPEFP 213 Psychromonas ingrahamii 37
Q8EH50        196 KPINLYVRADEQL---LAKIALSHGLLVSQGNKKTSLIKHHKTYRIYPHNQQPALCLLL 251 Shewanella oneidensis
Q086M9        155 KPISMYIRGDEKL---VARLALEQGILLSPGNKKTSLIKHHKTYVLMPSNLHQSLCLLC 210 Shewanella frigidimarina NCIMB 400
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap