Conserved Protein Domain Family
SplA

?
pfam11132: SplA 
Transcriptional regulator protein (SplA)
The SplA protein functions in trans as a negative regulator of the level of splB-lacZ expression in the developing forespore.
Statistics
?
PSSM-Id: 371391
View PSSM: pfam11132
Aligned: 9 rows
Threshold Bit Score: 100.549
Threshold Setting Gi: 961480026
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCG47497                4 QQPNYRAGDIVYVIYRNPHTYDVANVQEAAVVKDPENPGDLALFLYETYFPLDSEIAVYASQGEAERAYHDTF 76  Halobacillus ...
ADC49039                3 DMNQLHEGQSVYVIYRNPHTPTVSSIQEATIALDPMNPGQISLVLFDYYHPIEEDDAIFSSYEEAEASYDDYF 75  Bacillus pseu...
jgi:Bcell_1417          2 DITQLHPGDSVFVICRNPHTQSVAQIQEAAIVDHPDYPGRTVLFLFDDYMPLTDDYAMFNNYEEAEEMYNLYF 74  Bacillus cell...
ABV61965                7 PFSDYKPGDQVYVIYRNPHAANVAQIKEAEIVSHPYNEEELALFLLETYHPLAPDDAVFPTYEEAEALYQDLF 79  Bacillus pumi...
Q65KB4                  2 PRQPFKLGDEVYVIYRNPHAANVAHIKEAEVVDHPLHEGELALFMYDTYHAFAEDDAVFSSYEEAERLYRELF 74  Bacillus lich...
P37955                  1 mSNQFNAGDTVYVIYRNPHAANVAHIKEAEIVHHPYHEGELSLFIYETYHPFAEDDAVFASYEEAKSLYKELF 73  Bacillus subt...
IGS:BMQ_2225            2 EKKEYQVGDQVFVIYRNPHTANVANINQAEIVEHPENKGEKALFLHESYHLLAEDDAVYSTYEEAEKMYNKIF 74  Bacillus mega...
PRJNA212797:N288_12220  5 NPKEVKAGDEVFVIYNNPHTPTVSNIRAAEIVQHPKDPNAYALFLNETFHVIEDDDALFTSQAAAEKAFEEHY 77  Bacillus infa...
jgi:B1NLA3E_12350       9 epQNMRARDEVFVLYHNPHTPSVVNIKPAEIVQHPKDPDKLALFLNESFHLIEEDDALYSTEAAAEKAFAEFY 81  Bacillus sp. ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap