Conserved Protein Domain Family
PhrC_PhrF

?
pfam11131: PhrC_PhrF 
Rap-phr extracellular signalling
PhrC and PhrF stimulate ComA-dependent gene expression to different levels and are both required for full expression of genes activated by ComA, which activates the expression of genes involved in competence development and the production of several secreted products.
Statistics
?
PSSM-Id: 288035
Aligned: 2 rows
Threshold Bit Score: 33.0837
Created: 24-Mar-2022
Updated: 17-Oct-2022
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P94416  3 LKSKLFVICLAAAAIFTAAGVsANAEALDFHVTERGMT 40  Bacillus subtilis subsp. subtilis str. 168
P71001  3 LKSKLLLSCLALSTVFVATTI-ANAPTHQIEVAQRGMI 39  Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap