Conserved Protein Domain Family
Nucleocap_ssRNA

?
pfam11128: Nucleocap_ssRNA 
Plant viral coat protein nucleocapsid
This family of nucleocapsid proteins is from ssRNA negative-strand viruses of plant origin.
Statistics
?
PSSM-Id: 371390
View PSSM: pfam11128
Aligned: 2 rows
Threshold Bit Score: 382.927
Threshold Setting Gi: 81939856
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6DN64 227 RKVPEFVKSKLYDGDVSLSQISEELSHAPTKKFPARVFLKIDIDNLPSAVCSRCKLNIAGNRSVRYAGFASSFQTKQKLS 306 Citrus ringspot virus...
Q6DN64 227 RKVPEFVKSKLYDGDVSLSQISEELSHAPTKKFPARVFLKIDIDNLPSAVCSRCKLNIAGNRSVRYAGFASSFQTKQKLS 306 Citrus ringspot virus...
Q6DN64 307 PAVGATPESLMPLLETNQKIEKSIAIRDFLKTMEGQWKNQKRLHPLSDEKPTIKNFTLKLTCAIIYSLTPDGRIDMAERI 386 Citrus ringspot virus...
Q6DN64 307 PAVGATPESLMPLLETNQKIEKSIAIRDFLKTMEGQWKNQKRLHPLSDEKPTIKNFTLKLTCAIIYSLTPDGRIDMAERI 386 Citrus ringspot virus...
Q6DN64 387 ITDKNKGFQNDRNFFGDGE 405 Citrus ringspot virus isolate P-121
Q6DN64 387 ITDKNKGFQNDRNFFGDGE 405 Citrus ringspot virus isolate P-121
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap