Conserved Protein Domain Family
DNA_Packaging_2

?
pfam11123: DNA_Packaging_2 
DNA packaging protein
This DNA packaging protein is also referred to as gene 18 product (gp18). This protein is required for DNA packaging and functions in a complex with gp19.
Statistics
?
PSSM-Id: 402615
View PSSM: pfam11123
Aligned: 2 rows
Threshold Bit Score: 160.221
Threshold Setting Gi: 137613
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P03693  4 DKSLITFLEMLDTAMAQRMLADLSDHERRSPQLYNAINKLLDRHKFQIGKLQPDVHILGGLAGALEEYKEKVGDNGLTDD 83  Escherichia phage T7
P03693  4 DKSLITFLEMLDTAMAQRMLADLSDHERRSPQLYNAINKLLDRHKFQIGKLQPDVHILGGLAGALEEYKEKVGDNGLTDD 83  Escherichia phage T7
P03693 84 DI 85  Escherichia phage T7
P03693 84 DI 85  Escherichia phage T7
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap