Conserved Protein Domain Family
CBP_BcsF

?
pfam11120: CBP_BcsF 
Cellulose biosynthesis protein BcsF
CBP_BcsF is a family of bacterial cellulose biosynthesis proteins. Cellulose is necessary for biofilm formation in bacteria. (Roemling U. and Galperin M.Y. "Bacterial cellulose biosynthesis. Diversity of operons and subunits" (manuscript in preparation)).
Statistics
?
PSSM-Id: 402614
View PSSM: pfam11120
Aligned: 5 rows
Threshold Bit Score: 45.9027
Threshold Setting Gi: 81441068
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_013204398  1 MNLSDIVQILILVVLLLLLLKPVYARWLPKKWHRLMLRLTPPRALKYEGTWRRNAA 56  Erwinia
Q7CPI8        2 MTISDIVQIILFCALIFFPLGYLARHSLRRISDTTRLLFAKPRYVKPAGTLRRATK 57  Salmonella enterica subsp. enterica sero...
Q327S8        1 MTISDIIEIIVVCTLIFFPLGYLARHSLRRIRDTLRLFFAKPRYVKPAGTLRRTEK 56  Shigella dysenteriae Sd197
Q6CYY8        2 MNLIDIVQLVLLSAVIFFTLGYLAHRVIPHWIQYWKNRLLSPRYLKPASVWMRNPS 57  Pectobacterium atrosepticum
Q88JL8        1 MNFVQLLQVVGITALVTLGLALLLVRLCSALRGVLRRRL-PPRYLKPLGVRRRAAR 55  Pseudomonas putida KT2440
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap